GTDC1 Antibody

Images

 
Western Blot: GTDC1 Antibody [NBP1-83725] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: GTDC1 Antibody [NBP1-83725] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: GTDC1 Antibody [NBP1-83725] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTDC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HWGYLPSKDDYFQVLCMADVVISTAKHEFFGVAMLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCKRPDIIRKHLYKGEIAPFSWAAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTDC1 Protein (NBP1-83725PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTDC1 Antibody

  • FLJ11753
  • FLJ44822
  • glycosyltransferase-like 1
  • glycosyltransferase-like domain containing 1
  • glycosyltransferase-like domain-containing protein 1
  • mannosyltransferase candidate
  • mat-Xa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15452
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB7389
Species: Mu
Applications: WB, IHC
AF6379
Species: Hu
Applications: WB
AF7637
Species: Hu
Applications: WB
NBP1-86315
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87380
Species: Hu
Applications: IHC, IHC-P
NBP1-83725
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GTDC1 Antibody (NBP1-83725) (0)

There are no publications for GTDC1 Antibody (NBP1-83725).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTDC1 Antibody (NBP1-83725) (0)

There are no reviews for GTDC1 Antibody (NBP1-83725). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTDC1 Antibody (NBP1-83725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTDC1 Products

Bioinformatics Tool for GTDC1 Antibody (NBP1-83725)

Discover related pathways, diseases and genes to GTDC1 Antibody (NBP1-83725). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTDC1 Antibody (NBP1-83725)

Discover more about diseases related to GTDC1 Antibody (NBP1-83725).

Blogs on GTDC1

There are no specific blogs for GTDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTDC1