SPIRE2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SPIRE2 Antibody [NBP2-47261] - Staining of human cell line U-251 MG shows localization to nucleus, intermediate filaments & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SPIRE2 Antibody [NBP2-47261] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SPIRE2 Antibody [NBP2-47261] - Staining of human stomach, lower shows strong luminal membranous positivity in glandular cells.
Immunohistochemistry: SPIRE2 Antibody [NBP2-47261] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: SPIRE2 Antibody [NBP2-47261] - Staining of human Fallopian tube shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SPIRE2 Antibody [NBP2-47261] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPIRE2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLPCILNACSGDAKSTSCINLSVTDAGGSAQRPRPRVLLKAPTLAEMEEMNTSEEEESPCGEVTLKRDRSFSEHDLAQ
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPIRE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPIRE2 Protein (NBP2-47261PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPIRE2 Antibody

  • KIAA1832
  • MGC117166
  • protein spire homolog 2
  • SPIR2
  • spir-2
  • spire homolog 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92438
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24615
Species: Hu
Applications: IHC, IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NB300-213
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP2-00574
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86859
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89883
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56139
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-80467
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1195
Species: All-Multi
Applications: ICC, IHC, Simple Western, WB
NBP1-47745
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NLS1040
Species: Hu, Pm
Applications: IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP1-82292
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92211
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-47261
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SPIRE2 Antibody (NBP2-47261) (0)

There are no publications for SPIRE2 Antibody (NBP2-47261).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPIRE2 Antibody (NBP2-47261) (0)

There are no reviews for SPIRE2 Antibody (NBP2-47261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPIRE2 Antibody (NBP2-47261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPIRE2 Products

Bioinformatics Tool for SPIRE2 Antibody (NBP2-47261)

Discover related pathways, diseases and genes to SPIRE2 Antibody (NBP2-47261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SPIRE2 Antibody (NBP2-47261)

View related products by pathway.

Blogs on SPIRE2

There are no specific blogs for SPIRE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPIRE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPIRE2