SPIRE2 Antibody

Images

 
Western Blot: SPIRE2 Antibody [NBP1-79813] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPIRE2 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human SPIRE2The immunogen for this antibody is SPIRE2. Peptide sequence EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPIRE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SPIRE2 and was validated on Western blot.
Theoretical MW
80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPIRE2 Antibody

  • KIAA1832
  • MGC117166
  • protein spire homolog 2
  • SPIR2
  • spir-2
  • spire homolog 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92438
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24615
Species: Hu
Applications: IHC, IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NB300-213
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP2-00574
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86859
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89883
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56139
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-80467
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1195
Species: All-Multi
Applications: ICC, IHC, Simple Western, WB
NBP1-47745
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NLS1040
Species: Hu, Pm
Applications: IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP1-82292
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92211
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-79813
Species: Hu
Applications: WB

Publications for SPIRE2 Antibody (NBP1-79813) (0)

There are no publications for SPIRE2 Antibody (NBP1-79813).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPIRE2 Antibody (NBP1-79813) (0)

There are no reviews for SPIRE2 Antibody (NBP1-79813). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPIRE2 Antibody (NBP1-79813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPIRE2 Products

Bioinformatics Tool for SPIRE2 Antibody (NBP1-79813)

Discover related pathways, diseases and genes to SPIRE2 Antibody (NBP1-79813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SPIRE2 Antibody (NBP1-79813)

View related products by pathway.

Blogs on SPIRE2

There are no specific blogs for SPIRE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPIRE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPIRE2
Uniprot