Recombinant Human SPIC Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPIC Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 248 of Human SPIC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTCVEQDKLGQAFEDAFEVLRQHSTGDLQYSPDYRNYLALINHRPHVKGNSSCYGVLPTEEPVYNWRTVINSAADFYFEGNIHQSLQNITENQLVQPTLLQQKGGKGRKKLRLFEYLHESLYNPEMASCIQWVDKTKGIFQFVSKNKEKLAELWGKRKGNRKTMTYQKMARALRNYGRSGEITKIRRKLTYQFSEAILQRLSPSYFLGKEIFYSQCVQPDQEYLSLNNWNANYNYTYANYHELNHHDC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SPIC
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPIC Protein

  • MGC40611
  • Spi-C transcription factor (Spi-1/PU.1 related)
  • SPI-C
  • transcription factor Spi-C

Background

SPIC( AAH32317, 1 a.a. - 249 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP2-37458
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2797
Species: Hu
Applications: WB
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-80104
Species: Hu
Applications: WB
AF123
Species: Hu
Applications: WB, Block, ICC
NB100-65338
Species: Hu, Po, Ca, Pm
Applications: Flow, IHC, IHC-Fr, IP

Publications for SPIC Recombinant Protein (H00121599-P01) (0)

There are no publications for SPIC Recombinant Protein (H00121599-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPIC Recombinant Protein (H00121599-P01) (0)

There are no reviews for SPIC Recombinant Protein (H00121599-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPIC Recombinant Protein (H00121599-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPIC Products

Bioinformatics Tool for SPIC Recombinant Protein (H00121599-P01)

Discover related pathways, diseases and genes to SPIC Recombinant Protein (H00121599-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPIC Recombinant Protein (H00121599-P01)

Discover more about diseases related to SPIC Recombinant Protein (H00121599-P01).
 

Pathways for SPIC Recombinant Protein (H00121599-P01)

View related products by pathway.

PTMs for SPIC Recombinant Protein (H00121599-P01)

Learn more about PTMs related to SPIC Recombinant Protein (H00121599-P01).

Blogs on SPIC

There are no specific blogs for SPIC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
SPIC Antibody
NBP1-80288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPIC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPIC