Home » Speedy/Ringo » Speedy/Ringo Proteins » Recombinant Human Speedy/Ringo Protein

Recombinant Human Speedy/Ringo Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human Speedy/Ringo Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 313 of Human SPDYA full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SPDYA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
62.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00245711-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Speedy/Ringo Protein

  • hSpy/Ringo A
  • MGC110856
  • Rapid inducer of G2/M progression in oocytes A
  • RINGO A
  • RINGO3
  • SPDY1
  • speedy homolog 1 (Drosophila)
  • speedy homolog A (Xenopus laevis)
  • speedy protein A
  • speedy-1
  • Spy1
  • SPY1MGC57218

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDK2 Antibody (1A6)
NBP2-37507
Western Blot: CDK2 Antibody (1A6) [NBP2-37507] - Western blot analysis using CDK2 mouse mAb against Jurkat (1), HL-60 (2), K562(3), A431(4), HeLa(5), and NIH3T3 (6) cell lysate.
Immunocytochemistry/Immunofluorescence: CDK2 Antibody (1A6) [NBP2-37507] - Immunofluorescence analysis of HeLa cells using CDK2 mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: CDK2 Antibody (1A6) [NBP2-37507] - Immunohistochemical analysis of paraffin-embedded colon cancer tissues using CDK2 mouse mAb with DAB staining.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
p27/Kip1 [p
Thr157] Antibody
AF1555
Western blot shows lysates of MCF-7 human breast cancer cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF-I (Catalog # 291‑G1) for 20 minutes. PVDF membrane was probed with 0.5 µg/mL Human Phospho-p27/Kip1 (T157) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1555) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-p27/Kip1 (T157) was detected at approximately 27 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for 1 hour. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(11 Publications)
Species: Hu
Applications: WB
Speedy/Ringo
Antibody
NB100-2521
Western Blot: Speedy/Ringo Antibody [NB100-2521] - Detection of Speedy/Ringo in mouse testis (2ug/ml).
Immunohistochemistry-Paraffin: Speedy/Ringo Antibody [NB100-2521] - Speedy/Ringo was detected in immersion fixed paraffin-embedded sections of human testis using Rabbit Anti-Human Speedy/Ringo polyclonal Antibody (Catalog # NB100-2521) at 1:300 for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the nuclei of sperm cells.
(6 Publications)
Species: Hu, Mu, Rt, Sh
Applications: WB, ICC/IF, IHC, IHC-P
CDC2/CDK1 Antibody
NBP1-85729
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues. Corresponding CDK1 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
26S proteasome
subunit 9 Antibody
NBP2-47561
Western Blot: 26S proteasome subunit 9 Antibody [NBP2-47561] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue.
Immunocytochemistry/Immunofluorescence: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human skin using Anti-PSMD9 antibody.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
IFI27 Antibody
NBP1-84745
Immunohistochemistry-Paraffin: IFI27 Antibody [NBP1-84745] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
TMED7 Antibody
NBP1-90949
Western Blot: TMED7 Antibody [NBP1-90949] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: TMED7 Antibody [NBP1-90949] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
SSSCA1 Antibody
NBP2-13387
Western Blot: SSSCA1 Antibody [NBP2-13387] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: SSSCA1 Antibody [NBP2-13387] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: SSSCA1 Antibody [NBP2-13387] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Dynactin 6 Antibody
NBP1-80616
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Dynactin 6 Antibody [NBP1-80616] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(4 Reviews)
(24 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Choline kinase
alpha Antibody
NBP1-85630
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in control (vector only transfected HEK293T lysate) and CHKA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Species: Hu
Applications: WB, IHC, IHC-P
Histone H1
Antibody (21NC85)
NB100-65220
Immunohistochemistry: Histone H1 Antibody (21NC85) [NB100-65220] - FFPE pig heart stained with NB100-65220 at 1:500.
(1 Review)
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Chk1 Antibody
(2G1D5)
NB100-1768
Western Blot: Chk1 Antibody (2G1D5) [NB100-1768] - Western blot analysis using Chk1 mouse mAb against HEK293T cells transfected with the pCMV6-ENTRY control (1) and pCMV6-ENTRY Chk1 cDNA (2).
Immunocytochemistry/Immunofluorescence: Chk1 Antibody (2G1D5) [NB100-1768] - Chk1 antibody was tested at 1:10 in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x.
Immunohistochemistry-Paraffin: Chk1 Antibody (2G1D5) [NB100-1768] - IHC analysis of formalin fixed paraffin-embedded (FFPE) human lung using 1:250 conc. of Chk1 antibody (clone 2G1D5) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Cytoplasmic and nuclear staining of Chk1 was observed as this is a ubiquitous cell checkpoint protein. Staining was performed by Histowiz.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining in human lymph node and liver tissues using anti-POLD1 antibody. Corresponding POLD1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MOS Antibody
NBP1-86241
Western Blot: MOS Antibody [NBP1-86241] - Analysis in control (vector only transfected HEK293T lysate) and MOS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MOS Antibody [NBP1-86241] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
RFC2 Antibody
(OTI2B2)
NBP2-45570
Western Blot: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Immunohistochemistry: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of Adenocarcinoma of Human endometrium tissue.
Flow Cytometry: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by RFC2 antibody.
Species: Hu
Applications: WB, Flow, IHC

Publications for Speedy/Ringo Recombinant Protein (H00245711-P01)(1)


Reviews for Speedy/Ringo Recombinant Protein (H00245711-P01) (0)

There are no reviews for Speedy/Ringo Recombinant Protein (H00245711-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Speedy/Ringo Recombinant Protein (H00245711-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Speedy/Ringo Recombinant Protein (H00245711-P01)

Discover related pathways, diseases and genes to Speedy/Ringo Recombinant Protein (H00245711-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Speedy/Ringo Recombinant Protein (H00245711-P01)

Discover more about diseases related to Speedy/Ringo Recombinant Protein (H00245711-P01).
 

Pathways for Speedy/Ringo Recombinant Protein (H00245711-P01)

View related products by pathway.

PTMs for Speedy/Ringo Recombinant Protein (H00245711-P01)

Learn more about PTMs related to Speedy/Ringo Recombinant Protein (H00245711-P01).
 

Research Areas for Speedy/Ringo Recombinant Protein (H00245711-P01)

Find related products by research area.

Blogs on Speedy/Ringo

There are no specific blogs for Speedy/Ringo, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Speedy/Ringo Blocking Peptide
NB100-2521PEP
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
PCNA Antibody (PC10)
NB500-106
Western Blot: Speedy/Ringo Antibody [NB100-2521] - Detection of Speedy/Ringo in mouse testis (2ug/ml).
Speedy/Ringo Antibody
NB100-2521
Western Blot: CDK2 Antibody (1A6) [NBP2-37507] - Western blot analysis using CDK2 mouse mAb against Jurkat (1), HL-60 (2), K562(3), A431(4), HeLa(5), and NIH3T3 (6) cell lysate.
CDK2 Antibody (1A6)
NBP2-37507

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Speedy/Ringo Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SPDYA