SPATS2L Antibody

Images

 
Western Blot: SPATS2L Antibody [NBP2-85807] - Host: Rabbit. Target Name: SPATS2L. Sample Tissue: Human NCI-H226 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATS2L Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPATS2L. Peptide sequence: VDKAVQAFVDGSAIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDAKDKVE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SPATS2L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Publications
Read Publication using
NBP2-85807 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATS2L Antibody

  • DKFZp564A2416
  • DNA polymerase transactivated protein 6
  • DNA polymerase-transactivated protein 6
  • DNAPTP6SGNP
  • SPATS2-like protein
  • spermatogenesis associated, serine-rich 2-like
  • stress granule and nucleolar protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7895
Species: Hu
Applications: IHC, WB
NBP1-76864
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-82269
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00054738-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-92363
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF2009
Species: Hu
Applications: ICC, IHC
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP1-88402
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP2-85807
Species: Hu
Applications: WB

Publications for SPATS2L Antibody (NBP2-85807)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SPATS2L Antibody (NBP2-85807) (0)

There are no reviews for SPATS2L Antibody (NBP2-85807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPATS2L Antibody (NBP2-85807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPATS2L Products

Bioinformatics Tool for SPATS2L Antibody (NBP2-85807)

Discover related pathways, diseases and genes to SPATS2L Antibody (NBP2-85807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATS2L Antibody (NBP2-85807)

Discover more about diseases related to SPATS2L Antibody (NBP2-85807).

Blogs on SPATS2L

There are no specific blogs for SPATS2L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATS2L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATS2L