SPATA18 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RAMNVNPKISFPPVVDFCLLSDFIQEICCIAFAMQALEPPLDIAYGADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCVIMKGEAVTRR |
Predicted Species |
Mouse (93%), Rat (91%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SPATA18 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for SPATA18 Antibody
Background
Potential role in spermatogenesis, especially in cell differentiation from late elongate spematids to maturespermatozoa
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ch, Hu, Mu(-), Po, Rt, Xp
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: WB
Species: Av, Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Publications for SPATA18 Antibody (NBP2-48667) (0)
There are no publications for SPATA18 Antibody (NBP2-48667).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SPATA18 Antibody (NBP2-48667) (0)
There are no reviews for SPATA18 Antibody (NBP2-48667).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SPATA18 Antibody (NBP2-48667) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SPATA18 Products
Blogs on SPATA18