SPATA18 Antibody

Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP2-48667] - Analysis in human fallopian tube and prostate tissues using NBP2-48667 antibody. Corresponding SPATA18 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP2-48667] - Staining of human fallopian tube, lymph node, prostate and skin using Anti-SPATA18 antibody NBP2-48667 (A) shows similar protein distribution tissues.

Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP2-48667] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP2-48667] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP2-48667] - Staining of human prostate shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP2-48667] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Product Discontinued

SPATA18 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RAMNVNPKISFPPVVDFCLLSDFIQEICCIAFAMQALEPPLDIAYGADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCVIMKGEAVTRR
• Predicted Species: Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPATA18
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SPATA18 Antibody

• FLJ32906
• Mieap
• mitochondria-eating protein
• spermatogenesis associated 18 homolog (rat)
• Spermatogenesis-associated protein 18
• SPETEX1

Background

Potential role in spermatogenesis, especially in cell differentiation from late elongate spematids to maturespermatozoa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPATA18