SPAG9 Recombinant Protein Antigen

Images

 
There are currently no images for SPAG9 Protein (NBP1-85393PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SPAG9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPAG9.

Source: E. coli

Amino Acid Sequence: SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SPAG9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85393. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SPAG9 Recombinant Protein Antigen

  • Cancer/testis antigen 89
  • c-Jun NH2-terminal kinase-associated leucine zipper protein
  • C-Jun-amino-terminal kinase-interacting protein 4
  • CT89JIP4
  • FLJ14006
  • FLJ26141
  • FLJ34602
  • HLC4
  • HLC-6
  • HSS
  • Human lung cancer oncogene 6 protein
  • JLPPHETSYD1FLJ13450
  • JNK interacting protein
  • JNK/SAPK-associated protein
  • JNK-associated leucine-zipper protein
  • JNK-interacting protein 4
  • KIAA0516JIP-4
  • lung cancer oncogene 4
  • MAPK8IP4
  • Max-binding protein
  • MGC117291
  • MGC14967
  • MGC74461
  • Mitogen-activated protein kinase 8-interacting protein 4
  • PIG6
  • proliferation-inducing gene 6
  • Proliferation-inducing protein 6
  • Protein highly expressed in testis
  • sperm associated antigen 9
  • Sperm surface protein
  • Sperm-associated antigen 9
  • Sperm-specific protein
  • Sunday driver 1

Background

Extracellular signals are transduced into cells through mitogen-activated protein kinases. The structural organization of these kinases into specific signaling domains is facilitated by scaffolding proteins involved in closely tethering different kinases so that successive phosphorylation events can occur. The protein encoded by this gene is a scaffolding protein that brings together mitogen-activated protein kinases and their transcription factor targets for the activation of specific signaling pathways. This gene which is abundantly expressed in testicular haploid germ cells encodes a protein that is recognized by sperm-agglutinating antibodies and implicated in infertility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1205
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82474
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84999
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85416
Species: Hu
Applications: IHC,  IHC-P
236-EG
Species: Hu
Applications: BA
NBP1-88713
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-93736
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-90267
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF2429
Species: Mu
Applications: IHC, WB
NBP1-85393PEP
Species: Hu
Applications: AC

Publications for SPAG9 Protein (NBP1-85393PEP) (0)

There are no publications for SPAG9 Protein (NBP1-85393PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPAG9 Protein (NBP1-85393PEP) (0)

There are no reviews for SPAG9 Protein (NBP1-85393PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SPAG9 Protein (NBP1-85393PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPAG9 Products

Research Areas for SPAG9 Protein (NBP1-85393PEP)

Find related products by research area.

Blogs on SPAG9

There are no specific blogs for SPAG9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SPAG9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAG9