SPACA4 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPACA4 Antibody [NBP1-80793] - Staining in human testis and endometrium tissues using anti-SPACA4 antibody. Corresponding SPACA4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SPACA4 Antibody [NBP1-80793] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-SPACA4 antibody NBP1-80793 (A) shows similar protein distribution across tissues to independent antibody NBP2-38913 (B).

Western Blot: SPACA4 Antibody [NBP1-80793] - Analysis in control (vector only transfected HEK293T lysate) and SPACA4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SPACA4 Antibody [NBP1-80793] - Staining of human lymph node.

Immunohistochemistry-Paraffin: SPACA4 Antibody [NBP1-80793] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: SPACA4 Antibody [NBP1-80793] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: SPACA4 Antibody [NBP1-80793] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: SPACA4 Antibody [NBP1-80793] - Staining of human colon.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPACA4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPACA4 Antibody - BSA Free (NBP1-80793) is a polyclonal antibody validated for use in IHC, WB and ELISA. Anti-SPACA4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLPPR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPACA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SPACA4 Protein (NBP1-80793PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SPACA4 Antibody - BSA Free

• SAMP14Sperm acrosomal membrane-associated protein 14
• sperm acrosomal membrane protein 14
• sperm acrosome associated 4
• sperm acrosome membrane-associated protein 4

Background

Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion duringfertilization

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPACA4 Antibody (NBP1-80793)(2)

Publications using NBP1-80793

• Sun B, Wu H, Lu J et al. Irisin reduces bone fracture by facilitating osteogenesis and antagonizing TGF-beta /Smad signaling in a growing mouse model of osteogenesis imperfecta Journal of orthopaedic translation 2023-01-01 [PMID: 36439629] (ELISA)
• Ripolles-Garcia A, Chen Y, Sato Y et al. Retinal Vascular Plexuses Are Unequally Affected in Canine Inherited Retinal Degenerations Investigative ophthalmology & visual science 2022-11-01 [PMID: 36378130] (IHC-Fr, Canine)
  
  Details:
  Dilution used in IHC-Fr 1:500

Bioinformatics

• Gene Symbol: SPACA4
• Entrez:
  • 171169(Human)
• Uniprot:
  • Q8TDM5(Human)