SPACA3 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse SPACA3. Peptide sequence: RIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVD The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SPACA3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for SPACA3 Antibody
Background
Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion duringfertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which ispresent in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolyticactivity in vitro
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Publications for SPACA3 Antibody (NBP2-83578) (0)
There are no publications for SPACA3 Antibody (NBP2-83578).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SPACA3 Antibody (NBP2-83578) (0)
There are no reviews for SPACA3 Antibody (NBP2-83578).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SPACA3 Antibody (NBP2-83578) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SPACA3 Products
Bioinformatics Tool for SPACA3 Antibody (NBP2-83578)
Discover related pathways, diseases and genes to SPACA3 Antibody (NBP2-83578). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SPACA3 Antibody (NBP2-83578)
Discover more about diseases related to SPACA3 Antibody (NBP2-83578).
| | Pathways for SPACA3 Antibody (NBP2-83578)
View related products by pathway.
|
Blogs on SPACA3