SPACA3 Antibody

Images

 
Western Blot: SPACA3 Antibody [NBP2-83578] - Host: Rabbit. Target Name: Spaca3. Sample Type: Mouse Spleen lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPACA3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse SPACA3. Peptide sequence: RIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SPACA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPACA3 Antibody

  • CT54ALLP17Cancer/testis antigen 54
  • LYC3Sperm protein reactive with ASA
  • Lysozyme-like acrosomal sperm-specific secretory protein ALLP-17
  • Lysozyme-like protein 3
  • lysozyme-like sperm-specific secretory protein ALLP17
  • LYZL31700025M08Rik
  • SLLP1MGC119058
  • sperm acrosome associated 3
  • sperm acrosome membrane-associated protein 3
  • sperm lysozyme like protein 1
  • Sperm lysozyme-like protein 1
  • Sperm protein reactive with antisperm antibodies
  • SPRASA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81279
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-82810
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87715
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80792
Species: Hu
Applications: IHC, IHC-P, WB
NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
H00119180-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-58172
Species: Hu, Mu
Applications: WB
NBP1-88038
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85416
Species: Hu
Applications: IHC, IHC-P
NBP1-88809
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38952
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41184
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-89173
Species: Hu
Applications: IHC, IHC-P
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-19321
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-14921
Species: Hu
Applications: IHC, IHC-P, WB
AF8549
Species: Hu
Applications: Simple Western, WB

Publications for SPACA3 Antibody (NBP2-83578) (0)

There are no publications for SPACA3 Antibody (NBP2-83578).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPACA3 Antibody (NBP2-83578) (0)

There are no reviews for SPACA3 Antibody (NBP2-83578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPACA3 Antibody (NBP2-83578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPACA3 Products

Bioinformatics Tool for SPACA3 Antibody (NBP2-83578)

Discover related pathways, diseases and genes to SPACA3 Antibody (NBP2-83578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPACA3 Antibody (NBP2-83578)

Discover more about diseases related to SPACA3 Antibody (NBP2-83578).
 

Pathways for SPACA3 Antibody (NBP2-83578)

View related products by pathway.

Blogs on SPACA3

There are no specific blogs for SPACA3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPACA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPACA3