Home » Sp3 » Sp3 Antibodies » Sp3 Antibody (2F6)

Sp3 Antibody (2F6)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Sp3 Antibody (2F6) [H00006670-M08] - Analysis of SP3 expression in human stomach.
Western Blot: Sp3 Antibody (2F6) [H00006670-M08] - Analysis of SP3 expression in human stomach.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Sp3 Antibody (2F6) Summary

Immunogen
SP3 (NP_003102, 287 a.a. ~ 430 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN*
Specificity
SP3 (2F6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SP3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Sp3 Antibody (2F6)

  • DKFZp686O1631
  • GC-binding transcription factor Sp3
  • Sp3 transcription factor
  • Sp3
  • specificity protein 3
  • SPR2
  • SPR-2
  • transcription factor Sp3

Background

This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SP1 Antibody
NB600-233
Chromatin Immunoprecipitation: SP1 Antibody [NB600-233] - Chromatin from acute myeloid leukemia cell line was immunoprecipitated with anti-Sp1 antibody and analyzed by DNA sequencing. The figure illustrates the peak distribution of Sp1 binding within a 250 Kb region of chromosome 6 asdetected using anti-Sp1.
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-233] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-SP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Immunoprecipitation: SP1 Antibody [NB600-233] - Detection of human SP1 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-SP1 antibody NB600-233 (lot NB600-233-5) used for IP at 6 ug per reaction. SP1 was also immunoprecipitated by a previous lot of this antibody (NB600-233-4) and another rabbit anti-SP1 antibody. For blotting immunoprecipitated SP1, NB600-233 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(4 Publications)
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IHC, IHC-P, IP, WB
PSG1 [HRP]
DPSG10
(2 Publications)
Species: Hu
Applications: ELISA
COCO/DAND5
Antibody (OTI2H3)
NBP2-01223
Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.
Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-DAND5 mouse monoclonal antibody.
Species: Hu
Applications: Flow, IHC, IHC-P, WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
TFF2 was detected in immersion fixed paraffin-embedded sections of human stomach using Mouse Anti-Human TFF2 Monoclonal Antibody (Catalog # MAB4077) at 1.7 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to gastric glands. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Review)
(1 Publication)
Species: Hu
Applications: IHC, WB
SP2 Antibody
NBP1-83054
Immunocytochemistry/Immunofluorescence: SP2 Antibody [NBP1-83054] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SP2 Antibody [NBP1-83054] - Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SP4 Antibody
NBP2-97665
Immunocytochemistry/Immunofluorescence: SP4 Antibody [NBP2-97665] - Immunofluorescence staining of SP4 in U251MG cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-Human SP4 polyclonal antibody (dilution ratio 1:200) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG secondary antibody (green). Positive staining was localized to Nucleus.
Western Blot: SP4 Antibody [NBP2-97665] - Anti-SP4 rabbit polyclonal antibody at 1:500 dilution. Lane A: Hela Whole Cell Lysate Lane B: Jurkat Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 82 kDa. Observed band size: 97 kDa
Immunohistochemistry-Paraffin: SP4 Antibody [NBP2-97665] - Immunochemical staining of human SP4 in human lymph node with rabbit polyclonal antibody at 1:300 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EGR1 Antibody (6E8)
H00001958-M03
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody (M03), clone 6E8. Lane 1: EGR1 transfected lysatE (59.73 KDa). Lane 2: Non-transfected lysate.
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in Raw 264.7.
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in PC-12.
(2 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA/CF
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA/CF) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(700 Publications)
Species: Hu
Applications: BA
c-Fos Antibody
NBP1-89065
Immunocytochemistry/Immunofluorescence: c-Fos Antibody [NBP1-89065] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065] - Staining of human kidney shows weak to moderate nuclear positivity in cells in tubules.
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
VEGF [HRP]
DVE00
(26 Reviews)
(580 Publications)
Species: Hu
Applications: ELISA
NFkB p50 (NLS)
Inhibitor Peptide Set
NBP2-29323
Functional (Inhibition): NFkB p105/p50 Inhibitor Peptide Set [NBP2-29323] - TLR5/NF-kB/SEAPorter HEK 293 (NBP2-26277) cells were plated in 96-well plates at 5 x 10^4 cells/well for 16 h. Cells were preincubated with different concentrations (0, 1, 5, 10, 25 and 50 uM) of Inhibitory Peptide (NBP2-29323) and Control Peptide (NBP2-29334) for 1 h. Cells were then stimulated with 1 ng/ml Flagellin (NBP2-25289) for 24 h. Secreted alkaline phosphatase (SEAP) was analyzed using SEAPorter Assay Kit (NBP2-25285). *p < 0.05 versus control peptide at the corresponding concentrations (Mann-Whitney U test).
(12 Publications)
Species: Bv, Ca, Ch, Hu, Mu, Rt, Xp
Applications: Func-Inh
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Carcinoma of Human thyroid tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: IHC, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA: D4S234E Antibody (1C3) [H00027065-M01] - Detection limit for recombinant GST tagged D4S234E is approximately 0.1ng/ml as a capture antibody.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
FosB/G0S3 Antibody
(SN703)
NBP2-67710
Immunohistochemistry-Paraffin: FosB/G0S3 Antibody (SN703) [NBP2-67710] - Analysis of paraffin-embedded mouse brain tissue using anti-FosB antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: FosB/G0S3 Antibody (SN703) [NBP2-67710] - Analysis of paraffin-embedded rat spleen tissue using anti-FosB antibody. Counter stained with hematoxylin.
Western Blot: FosB/G0S3 Antibody (SN703) [NBP2-67710] - Analysis of FosB on human liver lysates using anti-FosB antibody at 1/1,000 dilution.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
JunD [p Ser255]
Antibody (JJ08-21)
NBP2-67861
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/Immunofluorescence: JunB/AP-1 Antibody [NBP1-89544] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Sp3 Antibody (2F6)
H00006670-M08
Sp3 Antibody (2F6)
Species: Hu
Applications: WB, ELISA

Publications for Sp3 Antibody (H00006670-M08) (0)

There are no publications for Sp3 Antibody (H00006670-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sp3 Antibody (H00006670-M08) (0)

There are no reviews for Sp3 Antibody (H00006670-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sp3 Antibody (H00006670-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sp3 Products

Array H00006670-M08

Bioinformatics Tool for Sp3 Antibody (H00006670-M08)

Discover related pathways, diseases and genes to Sp3 Antibody (H00006670-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sp3 Antibody (H00006670-M08)

Discover more about diseases related to Sp3 Antibody (H00006670-M08).
 

Pathways for Sp3 Antibody (H00006670-M08)

View related products by pathway.

PTMs for Sp3 Antibody (H00006670-M08)

Learn more about PTMs related to Sp3 Antibody (H00006670-M08).

Blogs on Sp3.

Check out the latest blog posts on Sp3.
Nur77 Activation and Tumor Suppression
Nur77 is a member of the steroid/thyroid hormone phosphoprotein receptor superfamily. It is heavily post-translationally modified and rapidly induced in response to androgens and growth factors. It governs fundamental processes such as cell proliferat...  Read full blog post.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sp3 Antibody (2F6) and receive a gift card or discount.


Bioinformatics

Gene Symbol SP3
Entrez
OMIM
Uniprot