Sp3 Antibody (2F6)

Images

 
Western Blot: Sp3 Antibody (2F6) [H00006670-M08] - Analysis of SP3 expression in human stomach.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Sp3 Antibody (2F6) Summary

Immunogen
SP3 (NP_003102, 287 a.a. ~ 430 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN*
Specificity
SP3 (2F6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SP3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Sp3 Antibody (2F6)

  • DKFZp686O1631
  • GC-binding transcription factor Sp3
  • Sp3 transcription factor
  • Sp3
  • specificity protein 3
  • SPR2
  • SPR-2
  • transcription factor Sp3

Background

This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-233
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IHC, IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP1-83054
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-97665
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
210-TA/CF
Species: Hu
Applications: BA
NBP1-89065
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-29323
Species: Bv, Ca, Ch, Hu, Mu, Rt, Xp
Applications: Func-Inh
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00006670-M08
Species: Hu
Applications: WB, ELISA

Publications for Sp3 Antibody (H00006670-M08) (0)

There are no publications for Sp3 Antibody (H00006670-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sp3 Antibody (H00006670-M08) (0)

There are no reviews for Sp3 Antibody (H00006670-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sp3 Antibody (H00006670-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sp3 Products

Array H00006670-M08

Bioinformatics Tool for Sp3 Antibody (H00006670-M08)

Discover related pathways, diseases and genes to Sp3 Antibody (H00006670-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sp3 Antibody (H00006670-M08)

Discover more about diseases related to Sp3 Antibody (H00006670-M08).
 

Pathways for Sp3 Antibody (H00006670-M08)

View related products by pathway.

PTMs for Sp3 Antibody (H00006670-M08)

Learn more about PTMs related to Sp3 Antibody (H00006670-M08).

Blogs on Sp3.

Nur77 Activation and Tumor Suppression
Nur77 is a member of the steroid/thyroid hormone phosphoprotein receptor superfamily. It is heavily post-translationally modified and rapidly induced in response to androgens and growth factors. It governs fundamental processes such as cell proliferat...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sp3 Antibody (2F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SP3
Entrez
OMIM
Uniprot