SOX6 Recombinant Protein Antigen

Images

 
There are currently no images for SOX6 Protein (NBP1-85811PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SOX6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOX6.

Source: E. coli

Amino Acid Sequence: TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SOX6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85811.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SOX6 Recombinant Protein Antigen

  • HSSOX6
  • SOX6
  • SOXD
  • SRY (sex determining region Y)-box 6
  • SRY-box containing gene 6
  • transcription factor SOX-6

Background

Sox genes comprise a family of genes that are related to the mammalian sex determining gene SRY. These genes similarly contain sequences that encode for the HMG-box domain, which is responsible for the sequence-specific DNA-binding activity. Sox genes encode putative transcriptional regulators implicated in the decision of cell fates during development and the control of diverse developmental processes. The highly complex group of Sox genes cluster at a minimum of 40 different loci that rapidly diverged in various animal lineages. At present 30 Sox genes have been identified, and members of this family have been shown to be conserved during evolution and to play key roles during animal development. Some are involved in human diseases, including sex reversal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5286
Species: Hu
Applications: WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-41295
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF2864
Species: Hu
Applications: ICC, IHC, WB
AF1705
Species: Mu
Applications: IHC, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
MAB7547
Species: Hu
Applications: ICC, WB
1206-F3
Species: Hu
Applications: BA
NBP1-89654
Species: Hu
Applications: IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
DY805
Species: Hu
Applications: ELISA

Publications for SOX6 Protein (NBP1-85811PEP) (0)

There are no publications for SOX6 Protein (NBP1-85811PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX6 Protein (NBP1-85811PEP) (0)

There are no reviews for SOX6 Protein (NBP1-85811PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SOX6 Protein (NBP1-85811PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOX6 Products

Blogs on SOX6

There are no specific blogs for SOX6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SOX6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX6