Somatostatin R4/SSTR4 Recombinant Protein Antigen

Images

 
There are currently no images for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Somatostatin R4/SSTR4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SSTR4.

Source: E. coli

Amino Acid Sequence: YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SSTR4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39022. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Somatostatin R4/SSTR4 Recombinant Protein Antigen

  • G-protein coupled receptor
  • Somatostatin R4
  • somatostatin receptor 4
  • somatostatin receptor type 4
  • SomatostatinR4
  • SS4R
  • SS-4-R
  • SS4-R
  • SSTR4

Background

SSTR4 has been reported to be expressed in brain, gastrointestinal tract, pancreas, and prostate tissues. No ESTs have been identified. G-protein Coupled Receptors (GPCRs) comprise one of the largest families of signaling molecules with more than a thousand members currently predicted to exist. All GPCRs share a structural motif consisting of seven membrane-spanning helices, and exist in both active and inactive forms. An array of activating ligands participate in the conformation of GPCRs which leads to signaling via G-proteins and downstream effectors. Ongoing studies have also shown the vast series of reactions which participate in the negative regulation of GPCRs. This "turn-off" activity has tremendous implications for the physiological action of the cell, and continues to drive pharmacological research for new drug candidates. Two blockbuster drugs which have been developed as GPCR-targeted pharmaceuticals are Zyprexa (Eli Lilly) and Claritin (Schering-Plough) which have multi-billion dollar shares of the mental health and allergy markets, respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2358
Species: Hu, Mu
Applications: ICC, IHC
NB300-157
Species: Hu, Mu, Po, Rt
Applications: EM, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-74540
Species: Hu, Mu, Po
Applications: Flow, ICC, IHC,  IHC-P, WB
NBP3-14480
Species: Hu
Applications: IHC,  IHC-P
NBP2-37266
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-00900
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-28745
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-48817
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
291-G1
Species: Hu
Applications: BA
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA

Publications for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP) (0)

There are no publications for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP) (0)

There are no reviews for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Somatostatin R4/SSTR4 Products

Research Areas for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP)

Find related products by research area.

Blogs on Somatostatin R4/SSTR4

There are no specific blogs for Somatostatin R4/SSTR4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Somatostatin R4/SSTR4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SSTR4