Somatostatin R4/SSTR4 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SSTR4. Source: E. coli
Amino Acid Sequence: YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SSTR4 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39022. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Somatostatin R4/SSTR4 Recombinant Protein Antigen
Background
SSTR4 has been reported to be expressed in brain, gastrointestinal tract, pancreas, and prostate tissues. No ESTs have been identified. G-protein Coupled Receptors (GPCRs) comprise one of the largest families of signaling molecules with more than a thousand members currently predicted to exist. All GPCRs share a structural motif consisting of seven membrane-spanning helices, and exist in both active and inactive forms. An array of activating ligands participate in the conformation of GPCRs which leads to signaling via G-proteins and downstream effectors. Ongoing studies have also shown the vast series of reactions which participate in the negative regulation of GPCRs. This "turn-off" activity has tremendous implications for the physiological action of the cell, and continues to drive pharmacological research for new drug candidates. Two blockbuster drugs which have been developed as GPCR-targeted pharmaceuticals are Zyprexa (Eli Lilly) and Claritin (Schering-Plough) which have multi-billion dollar shares of the mental health and allergy markets, respectively.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Rt
Applications: EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Po
Applications: Flow, ICC, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP) (0)
There are no publications for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP) (0)
There are no reviews for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP) (0)
Additional Somatostatin R4/SSTR4 Products
Research Areas for Somatostatin R4/SSTR4 Protein (NBP2-39022PEP)
Find related products by research area.
|
Blogs on Somatostatin R4/SSTR4