We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Solute carrier family 22 member 18 Recombinant Protein Antigen

Images

 
There are currently no images for Solute carrier family 22 member 18 Recombinant Protein Antigen (NBP2-57503PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Solute carrier family 22 member 18 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Solute carrier family 22 member 18.

Source: E. coli

Amino Acid Sequence: PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC22A18
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57503.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Solute carrier family 22 member 18 Recombinant Protein Antigen

  • BWR1AORCTL2
  • BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like
  • Efflux transporter-like protein
  • HET
  • imprinted multi-membrane spanning polyspecific transporter-related protein 1
  • Imprinted multi-membrane-spanning polyspecific transporter-related protein 1
  • IMPT1DKFZp667A184
  • ITMp45-BWR1A
  • ORCTL-2
  • organic cation transporter-like 2
  • Organic cation transporter-like protein 2
  • p45 Beckwith-Wiedemann region 1A
  • SLC22A1Lcandidate A
  • solute carrier family 22 member 18
  • Solute carrier family 22 member 1-like
  • solute carrier family 22, member 18
  • TSSC5p45-Beckwith-Wiedemann region 1 A
  • Tumor-suppressing STF cDNA 5 protein
  • Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein

Background

Solute carrier family 22 member 18 is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney. Two alternative transcripts encoding the same isoform have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1347
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
292-G2
Species: Hu
Applications: BA
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP1-78983
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB (-)
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-39093
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-65805
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
H00011151-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-93054
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-81351
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-83280
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
NBP2-57503PEP
Species: Hu
Applications: AC

Publications for Solute carrier family 22 member 18 Recombinant Protein Antigen (NBP2-57503PEP) (0)

There are no publications for Solute carrier family 22 member 18 Recombinant Protein Antigen (NBP2-57503PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Solute carrier family 22 member 18 Recombinant Protein Antigen (NBP2-57503PEP) (0)

There are no reviews for Solute carrier family 22 member 18 Recombinant Protein Antigen (NBP2-57503PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Solute carrier family 22 member 18 Recombinant Protein Antigen (NBP2-57503PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Solute carrier family 22 member 18 Products

Blogs on Solute carrier family 22 member 18

There are no specific blogs for Solute carrier family 22 member 18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Solute carrier family 22 member 18 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A18