Sodium Potassium ATPase Alpha 3 Recombinant Protein Antigen

Images

 
There are currently no images for Sodium Potassium ATPase Alpha 3 Protein (NBP2-37955PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Sodium Potassium ATPase Alpha 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP1A3.

Source: E. coli

Amino Acid Sequence: EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP1A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37955.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Sodium Potassium ATPase Alpha 3 Recombinant Protein Antigen

  • alpha 3 polypeptide
  • ATP1A3
  • ATPase, Na+/K+ transporting, alpha 3 polypeptide
  • dystonia 12
  • DYT12
  • EC 3.6.3
  • MGC13276
  • RDP
  • Sodium Potassium ATPase Alpha 3
  • Sodium pump subunit alpha-3
  • sodium/potassium-transporting ATPase alpha-3 chain
  • sodium/potassium-transporting ATPase subunit alpha-3

Background

The sodium/potassium ATPase is an integral membrane enzyme found in all cells of higher organisms and is responsible for the ATP-dependent transport of sodium and potassium across the cell membrane. This membrane-bound enzyme is related to a number of other ATPases including sarcoplasmic and endoplasmic reticulum calcium ATPase (SERCA) and plasma membrane calcium ATPase (PMCA). The sodium/potassium ATPase consists of a large, multipass, transmembrane catalytic subunit, termed the alpha subunit, and an associated smaller glycoprotein, termed the beta subunit. Studies indicate that there are three isoforms of the alpha subunit (alpha 1, alpha 2, alpha 3) and two isoforms of the beta subunit (beta 1 and beta 2) encoded by two multigene families. The different isoforms of the sodium/potassium ATPase exhibit tissue-specific and developmental patterns of expression. The alpha 1 and beta mRNAs are present in all cell types examined, whereas the alpha 2 and alpha 3 mRNAs exhibit a more restricted pattern of cell-specific expression. The alpha-3 subunit has been found in neuronal and to skeletal and cardiac muscle, lung and stomach tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-03780
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
NBP3-45254
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB1980
Species: Hu
Applications: ICC, IP, Simple Western, WB
NB300-146
Species: Bv, Ca, Dr, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh, Xp, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-94614
Species: Mu, Rt
Applications: WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-59794
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-32061
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-77847
Species: Hu, Mu
Applications: ChIP, ELISA, IHC,  IHC-P, IP, WB
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-55165
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for Sodium Potassium ATPase Alpha 3 Protein (NBP2-37955PEP) (0)

There are no publications for Sodium Potassium ATPase Alpha 3 Protein (NBP2-37955PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sodium Potassium ATPase Alpha 3 Protein (NBP2-37955PEP) (0)

There are no reviews for Sodium Potassium ATPase Alpha 3 Protein (NBP2-37955PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Sodium Potassium ATPase Alpha 3 Protein (NBP2-37955PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sodium Potassium ATPase Alpha 3 Products

Blogs on Sodium Potassium ATPase Alpha 3

There are no specific blogs for Sodium Potassium ATPase Alpha 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Sodium Potassium ATPase Alpha 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP1A3