SODD/BAG4 Antibody

Images

 
Western Blot: SODD/BAG4 Antibody [NBP1-87017] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: SODD/BAG4 Antibody [NBP1-87017] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SODD/BAG4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGNATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BAG4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SODD/BAG4 Protein (NBP1-87017PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (81%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SODD/BAG4 Antibody

  • BAG4
  • BAG-4
  • BAG-family molecular chaperone regulator-4
  • Bcl-2-associated athanogene 4
  • BCL2-associated athanogene 4
  • Silencer of death domains
  • SODD
  • SODDBAG family molecular chaperone regulator 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
126-FL/CF
Species: Hu
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87017
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SODD/BAG4 Antibody (NBP1-87017) (0)

There are no publications for SODD/BAG4 Antibody (NBP1-87017).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SODD/BAG4 Antibody (NBP1-87017) (0)

There are no reviews for SODD/BAG4 Antibody (NBP1-87017). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SODD/BAG4 Antibody (NBP1-87017) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SODD/BAG4 Products

Bioinformatics Tool for SODD/BAG4 Antibody (NBP1-87017)

Discover related pathways, diseases and genes to SODD/BAG4 Antibody (NBP1-87017). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SODD/BAG4 Antibody (NBP1-87017)

Discover more about diseases related to SODD/BAG4 Antibody (NBP1-87017).
 

Pathways for SODD/BAG4 Antibody (NBP1-87017)

View related products by pathway.

PTMs for SODD/BAG4 Antibody (NBP1-87017)

Learn more about PTMs related to SODD/BAG4 Antibody (NBP1-87017).
 

Research Areas for SODD/BAG4 Antibody (NBP1-87017)

Find related products by research area.

Blogs on SODD/BAG4

There are no specific blogs for SODD/BAG4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SODD/BAG4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BAG4
Entrez