SNX3 Antibody

Images

 
Western Blot: SNX3 Antibody [NBP2-86824] - Host: Rabbit. Target Name: SNX3. Sample Tissue: Human A172 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SNX3. Peptide sequence: TVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SNX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX3 Antibody

  • Grd19
  • MCOPS8
  • MGC17570
  • Protein SDP3
  • SDP3
  • sorting nexin 3
  • sorting nexin 3A
  • sorting nexin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75670
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-00253
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NB100-79791
Species: Hu
Applications: WB
NBP1-87174
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
PP-H6506-00
Species: Hu
Applications: WB, IP, DirELISA
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009146-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, RNAi, S-ELISA
NBP1-55046
Species: Hu
Applications: WB
NBP1-88766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49242
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-45894
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85921
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2307
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-86824
Species: Hu
Applications: WB

Publications for SNX3 Antibody (NBP2-86824) (0)

There are no publications for SNX3 Antibody (NBP2-86824).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX3 Antibody (NBP2-86824) (0)

There are no reviews for SNX3 Antibody (NBP2-86824). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNX3 Antibody (NBP2-86824) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SNX3 Products

Bioinformatics Tool for SNX3 Antibody (NBP2-86824)

Discover related pathways, diseases and genes to SNX3 Antibody (NBP2-86824). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX3 Antibody (NBP2-86824)

Discover more about diseases related to SNX3 Antibody (NBP2-86824).
 

Pathways for SNX3 Antibody (NBP2-86824)

View related products by pathway.

PTMs for SNX3 Antibody (NBP2-86824)

Learn more about PTMs related to SNX3 Antibody (NBP2-86824).
 

Research Areas for SNX3 Antibody (NBP2-86824)

Find related products by research area.

Blogs on SNX3

There are no specific blogs for SNX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX3