![Western Blot: SNX25 Antibody (3A8) [H00083891-M01] - Analysis of SNX25 expression in transfected 293T cell line by SNX25 monoclonal antibody (M01), clone 3A8.Lane 1: SNX25 transfected lysate(56.3 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SNX25-Antibody-3A8-Western-Blot-H00083891-M01-img0003.jpg "Western Blot: SNX25 Antibody (3A8) [H00083891-M01] - Analysis of SNX25 expression in transfected 293T cell line by SNX25 monoclonal antibody (M01), clone 3A8.Lane 1: SNX25 transfected lysate(56.3 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 3A8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse SNX25 Antibody (3A8) - Azide and BSA Free (H00083891-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | SNX25 (AAH29868, 1 a.a. ~ 483 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQQCLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMGPRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQEETEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV |
| Specificity | SNX25 - sorting nexin 25 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SNX25 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SNX25 Antibody (H00083891-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: SNX25 Antibody (3A8) [H00083891-M01] - Detection limit for recombinant GST tagged SNX25 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SNX25-Antibody-3A8-Sandwich-ELISA-H00083891-M01-img0002.jpg "Sandwich ELISA: SNX25 Antibody (3A8) [H00083891-M01] - Detection limit for recombinant GST tagged SNX25 is approximately 0.3ng/ml as a capture antibody.")
![N/A Serpin F1/PEDF [Biotin]](https://images.novusbio.com/images2/DATA_Serpin_F1_DY117705_ELISA_2344.jpg)
![Western Blot LITAF Antibody [Unconjugated]](https://images.novusbio.com/images2/LITAF_AF4695_Western_Blot_5526.jpg)
![Immunocytochemistry LITAF Antibody [Unconjugated]](https://images.novusbio.com/images2/LITAF_AF4695_Immunocytochemistry__Immunofluorescence_18996.jpg)
![Immunohistochemistry LITAF Antibody [Unconjugated]](https://images.novusbio.com/images2/LITAF_AF4695_Immunohistochemistry_19619.jpg)
![Western Blot PEDFR/PNPLA2/ATGL Antibody [Unconjugated]](https://images.novusbio.com/images2/PEDF_R_AF5365_Western_Blot_5700.jpg)
![Simple Western PEDFR/PNPLA2/ATGL Antibody [Unconjugated]](https://images.novusbio.com/images2/PEDF_R_AF5365_Simple_Western_17547.jpg)
![Immunohistochemistry PEDFR/PNPLA2/ATGL Antibody [Unconjugated]](https://images.novusbio.com/images2/PEDF_R_AF5365_Immunohistochemistry_6870.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB](https://images.novusbio.com/images/Goat-anti-Mouse-IgG-H+L-Secondary-Antibody-HRP-Immunohistochemistry-Paraffin-NB7539-img0014.jpg "Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")