Recombinant Human SNX20 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SNX20 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 129 of Human SLIC1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVMGKSRPGEMTYPGSRGETGTAPEPDPRCPRQSDML

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SNX20
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
40.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SNX20 Protein

  • MGC35578
  • selectin ligand interactor cytoplasmic-1
  • Selectin ligand-interactor cytoplasmic 1
  • SLIC-1
  • SLIC1selectin ligand interactor cytoplasmic 1
  • sorting nexin 20
  • sorting nexin-20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NBP1-05185
Species: Hu, Bv
Applications: ELISA, IHC, IHC-Fr, IHC-P, IP
AF5510
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026531-P01
Species: Hu
NBP1-76638
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-85935
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31052
Species: Hu
Applications: WB, IHC, IHC-P
NB100-356
Species: Hu, Rb
Applications: WB, Simple Western, B/N, ICC/IF, IHC, IHC-P
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-15078
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01828
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SNX20 Recombinant Protein (H00124460-P01) (0)

There are no publications for SNX20 Recombinant Protein (H00124460-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX20 Recombinant Protein (H00124460-P01) (0)

There are no reviews for SNX20 Recombinant Protein (H00124460-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNX20 Recombinant Protein (H00124460-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SNX20 Products

Bioinformatics Tool for SNX20 Recombinant Protein (H00124460-P01)

Discover related pathways, diseases and genes to SNX20 Recombinant Protein (H00124460-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX20 Recombinant Protein (H00124460-P01)

Discover more about diseases related to SNX20 Recombinant Protein (H00124460-P01).
 

Pathways for SNX20 Recombinant Protein (H00124460-P01)

View related products by pathway.

Research Areas for SNX20 Recombinant Protein (H00124460-P01)

Find related products by research area.

Blogs on SNX20

There are no specific blogs for SNX20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SNX20 Antibody
NBP1-92418
P-Selectin/CD62P
137-PS-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SNX20 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX20