SNX15 Antibody (1D4)

Western Blot: SNX15 Antibody (1D4) [H00029907-M01] - Analysis of SNX15 expression in transfected 293T cell line by SNX15 monoclonal antibody (M01), clone 1D4.Lane 1: SNX15 transfected lysate (Predicted MW: 38.3 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

SNX15 Antibody (1D4) Summary

• Immunogen: SNX15 (NP_037438, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGGEVTRPLEVSRDLH
• Specificity: SNX15 - sorting nexin 15
• Isotype: IgG3 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SNX15
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNX15 Antibody (1D4)

• clone iota unknown protein
• HSAF001435
• sorting nexin 15
• sorting nexin-15

Background

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. Overexpression of this gene results in a decrease in the processing of insulin and hepatocyte growth factor receptors to their mature subunits. This decrease is caused by the mislocalization of furin, the endoprotease responsible for cleavage of insulin and hepatocyte growth factor receptors. This protein is involved in endosomal trafficking from the plasma membrane to recycling endosomes or the trans-Golgi network. This gene encodes two transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNX15
• Entrez:
  • 29907(Human)
• OMIM:
  • 605964(Human)
• Uniprot:
  • NP_037438(Human)