SNTB2 Antibody (3F12) - Azide and BSA Free

Sandwich ELISA: SNTB2 Antibody (3F12) [H00006645-M01] - Detection limit for recombinant GST tagged SNTB2 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 3F12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SNTB2 Antibody (3F12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SNTB2 (NP_006741.1, 116 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLV
• Specificity: Reacts with syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2).
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SNTB2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNTB2 Antibody (3F12) - Azide and BSA Free

• D16S2531E
• EST25263
• SNT2B2dystrophin-associated protein A1, 59kD, basic component 2
• SNT3beta-2-syntrophin
• SNTLsyntrophin-3
• syntrophin, beta 2 (dystrophin-associated protein A1, 59kD, basic component 2)
• syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2)
• Syntrophin-3,59 kDa dystrophin-associated protein A1 basic component 2
• Syntrophin-like

Background

Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNTB2
• Entrez:
  • 6645(Human)
• Uniprot:
  • NP_006741(Human)