SNRPB2 Antibody (2F4)

Images

 
Sandwich ELISA: SNRPB2 Antibody (2F4) [H00006629-M01] - Detection limit for recombinant GST tagged SNRPB2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SNRPB2 Antibody (2F4) Summary

Immunogen
SNRPB2 (AAH36737, 1 a.a. - 225 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
Specificity
SNRPB2 - small nuclear ribonucleoprotein polypeptide B' (2F4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SNRPB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNRPB2 Antibody (2F4)

  • MGC24807
  • MGC45309
  • Msl1
  • small nuclear ribonucleoprotein polypeptide B
  • small nuclear ribonucleoprotein polypeptide B''
  • small nuclear ribonucleoprotein polypeptide B2
  • U2 small nuclear ribonucleoprotein B''
  • U2 snRNP B''

Background

The protein encoded by this gene associates with stem loop IV of U2 small nuclear ribonucleoprotein (U2 snRNP) in the presence of snRNP-A'. The encoded protein may play a role in pre-mRNA splicing. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28879
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00010943-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-53095
Species: Hu, Mu, Rt, Po, Bv, Mk, Rb, Sh, Ze
Applications: WB, ICC/IF, IHC-P
AF844
Species: Mu
Applications: WB, Block
NBP2-33447
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-57100
Species: Hu
Applications: ICC/IF
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00006629-M01
Species: Hu
Applications: ELISA

Publications for SNRPB2 Antibody (H00006629-M01) (0)

There are no publications for SNRPB2 Antibody (H00006629-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNRPB2 Antibody (H00006629-M01) (0)

There are no reviews for SNRPB2 Antibody (H00006629-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SNRPB2 Antibody (H00006629-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNRPB2 Products

Bioinformatics Tool for SNRPB2 Antibody (H00006629-M01)

Discover related pathways, diseases and genes to SNRPB2 Antibody (H00006629-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNRPB2 Antibody (H00006629-M01)

Discover more about diseases related to SNRPB2 Antibody (H00006629-M01).
 

Pathways for SNRPB2 Antibody (H00006629-M01)

View related products by pathway.

Blogs on SNRPB2

There are no specific blogs for SNRPB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNRPB2 Antibody (2F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRPB2
Entrez
Uniprot