Recombinant Human SNRP70 GST (N-Term) Protein

SDS-Page: Recombinant Human SNRP70 Protein [H00006625-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human SNRP70 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-122 of Human SNRP70
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGGDGYLAPENGYLMEAAPE

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: SNRNP70
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 39.05 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SNRP70 GST (N-Term) Protein

• RNPU1ZU170K
• RPU1U1AP
• small nuclear ribonucleoprotein 70kDa (U1)
• Snp1
• snRNP70
• SNRP70U1 small nuclear ribonucleoprotein 70 kDa
• U1 snRNP 70 kDa
• U1-70Ksmall nuclear ribonucleoprotein 70kDa (RNP antigen)
• U1AP1
• U1RNP

Background

SNRP70( AAH00342, 1 a.a. - 123 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for SNRP70 Recombinant Protein (H00006625-P01). (Showing 1 - 1 of 1 FAQ).

1. First of all, I need information about the purity of the product, then about it's formulation and availability. Also, are the prices as given on the web page?
   • The purification method used was Glutathione Sepharose 4 Fast Flow. The notes we have about its buffer are as follows: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. The percent purity of the protein H00006625-P01 is unknown, because the manufacturer (Abnova) has not tested it. However, they are ISO certified. Regarding the price and availability of this product, please use our website to select your country, which will allow you to view the country specific pricing, availability and technical support information.

Bioinformatics

• Gene Symbol: SNRNP70