SMR3B Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse SMR3B Antibody - Azide and BSA Free (H00010879-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
SMR3B (AAH15327, 1 a.a. - 79 a.a.) full-length human protein. MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP |
| Specificity |
SMR3B - submaxillary gland androgen regulated protein 3 homolog B (mouse), |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
SMR3B |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SMR3B Antibody - Azide and BSA Free
Background
SMR3B, also known as Submaxillary gland androgen-regulated protein 3B, is a 79 amino acid protein that is 8 kDa, secreted into saliva by submaxillary gland. Little is currently known about SMR3B protein function. The protein is being studied for its involvement in pancytopenia. Interactions with SMR3B protein have shown to involve MUC7, EIF4A2, ATP1B3, TNPO2, UBE4A, ATAD3A, MSH2, TTC27, KIAA1279, RAB3GAP2, USO1, PTP4A3, CNNM3, and other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Av, Bv, Sh
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: Flow, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Publications for SMR3B Antibody (H00010879-B01P) (0)
There are no publications for SMR3B Antibody (H00010879-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SMR3B Antibody (H00010879-B01P) (0)
There are no reviews for SMR3B Antibody (H00010879-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SMR3B Antibody (H00010879-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SMR3B Products
Blogs on SMR3B