Home » SMR3B » SMR3B Antibodies » SMR3B Antibody

SMR3B Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SMR3B Antibody [H00010879-B01P] - Analysis of SMR3B expression in transfected 293T cell line by SMR3B polyclonal antibody. Lane 1: SMR3B transfected lysate(8.69 KDa). Lane 2: Non-transfected lysate.
Western Blot: SMR3B Antibody [H00010879-B01P] - Analysis of SMR3B expression in transfected 293T cell line by SMR3B polyclonal antibody. Lane 1: SMR3B transfected lysate(8.69 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SMR3B Antibody Summary

Immunogen
SMR3B (AAH15327, 1 a.a. - 79 a.a.) full-length human protein. MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP
Specificity
SMR3B - submaxillary gland androgen regulated protein 3 homolog B (mouse),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SMR3B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMR3B Antibody

  • P-B
  • PBIIMGC104379
  • PRL3submaxillary gland androgen regulated protein 3 homolog B (mouse)
  • PROL3
  • proline rich 3
  • Proline-rich peptide P-B
  • Proline-rich protein 3
  • salivary proline-rich protein
  • SMR1B
  • submaxillary gland androgen regulated protein 3 homolog B
  • submaxillary gland androgen regulated protein 3B
  • submaxillary gland androgen-regulated protein 3B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

C4 binding protein
A Antibody
NBP1-88263
Western Blot: C4 binding protein A Antibody [NBP1-88263] - Analysis in human cell line RT-4, human cell line U-251 MG, human cell line A-431, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: C4 binding protein A Antibody [NBP1-88263] - Staining of human liver using Anti-C4BPA antibody.
Immunohistochemistry-Paraffin: C4 binding protein A Antibody [NBP1-88263] - Staining of human lung using Anti-C4BPA antibody.
Species: Hu
Applications: IHC, IHC-P, WB
PrPC Antibody
(SC57-05)
NBP2-67569
Flow Cytometry: PrPC Antibody (SC57-05) [NBP2-67569] - Analysis of SH-SY-5Y cells with PrPC antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: PrPC Antibody (SC57-05) [NBP2-67569] - Staining PrPC in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: PrPC Antibody (SC57-05) [NBP2-67569] - Staining PrPC in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Peroxiredoxin 2
Antibody (4E10-2D2)
H00007001-M01
ELISA: Peroxiredoxin 2 Antibody (4E1.0-2D2) [H00007001-M01] - Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Detection limit for recombinant GST tagged PRDX2 is approximately 1ng/ml as a capture antibody.
Knockdown Validated: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 knockdown increases PRDX4 protein levels in HeLa cells. HeLa subclones were exposed to 20% or 1% O2 for indicated time. Each WCL was subject to immunoblot assays with the indicated antibodies (PRDX2 H00007001-M01 and PRDX4 NBP1-31435). Image collected and cropped by CiteAb from the following publication (oncotarget.com/abstract/7142), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on HeLa cell. Antibody concentration 10 ug/ml.
(1 Review)
(6 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
ABCB6 Antibody
NBP2-58327
Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Immunocytochemistry/Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, WB
CARD14 Antibody
NBP2-92873
Western Blot: CARD14 Antibody [NBP2-92873] - Analysis of extracts of various cell lines, using CARD14 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
STATH Antibody
NBP1-92450
Immunohistochemistry-Paraffin: STATH Antibody [NBP1-92450] - Staining of human salivary gland shows high expression.
Immunohistochemistry-Paraffin: STATH Antibody [NBP1-92450] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: STATH Antibody [NBP1-92450] - Staining in human salivary gland and skeletal muscle tissues using anti-STATH antibody. Corresponding STATH RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Pit1 Antibody
NBP1-92273
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
(15 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P
SMR3A Antibody
NBP1-58000
Western Blot: SMR3A Antibody [NBP1-58000] - Titration: 0.2-1 ug/ml, Positive Control: Human Small Intestine.
Species: Hu
Applications: WB
Histatin 3
Antibody (4G9)
H00003347-M01
Sandwich ELISA: Histatin 3 Antibody (4G9) [H00003347-M01] - Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01] - Analysis of monoclonal antibody to HTN3 on HeLa cell . Antibody concentration 10 ug/ml.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Prolactin Antibody
[Unconjugated]
AF682
Recombinant Human Prolactin (Catalog # 682-PL) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Prolactin (0.5 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682). The ND50 is typically 0.02-0.05 µg/mL.
Prolactin was detected in immersion fixed paraffin-embedded sections of human testis using Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of sperm cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human pituitary tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Prolactin at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
APOBEC3C Antibody
NBP1-00131
Western Blot: APOBEC3C Antibody [NBP1-00131] - Staining of Daudi lysate with antibody at 0.5 ug/mL (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Flow Cytometry: APOBEC3C Antibody [NBP1-00131] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Publication)
Species: Hu
Applications: Flow, PEP-ELISA, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
PRL-3/PTP4A3
Antibody (334402)
MAB3219
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, Neuro‑2A mouse neuroblastoma cell line, and Nb2‑11 rat lymphoma cell line. PVDF membrane was probed with 0.3 µg/mL of Human/Mouse/Rat PRL‑3 Monoclonal Antibody (Catalog # MAB3219) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for PRL‑3 at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB
Histatin 1 Antibody
NBP3-17592
Immunohistochemistry-Paraffin: Histatin 1 Antibody [NBP3-17592] - Staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
GP1BB Antibody
NBP3-04913
Western Blot: GP1BB Antibody [NBP3-04913] - Analysis of extracts of various cell lines, using GP1BB antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Species: Hu, Mu, Rt
Applications: WB
Blooms Syndrome
Protein Blm Antibody
NB100-214
Immunoprecipitation: Blooms Syndrome Protein Blm Antibody [NB100-214] - Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-BLM antibody (NB100-214, lot 4) used for IP at 6 ug per reaction. BLM was also immunoprecipitated by a previous lot of this antibody (lot 3). For blotting immunoprecipitated BLM, NB100-214 was used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: Blooms Syndrome Protein Blm Antibody [NB100-214] - Samples: Whole cell lysate (50 ug) from TCMK-1 and BIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-BLM antibody NB100-214 (lot 4) used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 75 seconds.
Western Blot: Blooms Syndrome Protein Blm Antibody [NB100-214] - Samples: Whole cell lysate (15 ug) from HEK293T, K-562, Jurkat, HeLa, and A-549 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-BLM antibody NB100-214 (lot 4) used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(7 Publications)
Species: Hu, Mu
Applications: IP, WB
Recombinant Human
PRH1 His Protein
NBP2-23368
SDS-Page: PRH1 Protein [NBP2-23368]
Species: Hu
Applications: PAGE
Recombinant Human
PROL1 GST (N-Term) Pr ...
H00058503-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Western Blot: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis using Anti-PAH antibody NBP2-48615 (A) shows similar pattern to independent antibody NBP1-80917 (B).
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis in human liver and pancreas tissues. Corresponding Phenylalanine Hydroxylase RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Species: Hu
Applications: IHC, IHC-P, WB

Publications for SMR3B Antibody (H00010879-B01P) (0)

There are no publications for SMR3B Antibody (H00010879-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMR3B Antibody (H00010879-B01P) (0)

There are no reviews for SMR3B Antibody (H00010879-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMR3B Antibody (H00010879-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMR3B Products

Bioinformatics Tool for SMR3B Antibody (H00010879-B01P)

Discover related pathways, diseases and genes to SMR3B Antibody (H00010879-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMR3B Antibody (H00010879-B01P)

Discover more about diseases related to SMR3B Antibody (H00010879-B01P).
 

Pathways for SMR3B Antibody (H00010879-B01P)

View related products by pathway.

PTMs for SMR3B Antibody (H00010879-B01P)

Learn more about PTMs related to SMR3B Antibody (H00010879-B01P).

Blogs on SMR3B

There are no specific blogs for SMR3B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMR3B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SMR3B
Entrez
Uniprot