SMPD4 Antibody

Images

 
Western Blot: SMPD4 Antibody [NBP2-33567] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SMPD4 Antibody [NBP2-33567] - Staining of human cell line MCF7 shows localization to nuclear membrane.
Immunohistochemistry-Paraffin: SMPD4 Antibody [NBP2-33567] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMPD4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LAQLITQAKHTAKSISDQCAESPAGHSFLSWLGFSSMDTNGSYTANDLDEMGQDSVRKTDEYLEKALEYLRQIFRLSEAQLRQFTLALGTTQDENGKKQLPDCI
Specificity
Specificity of human SMPD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMPD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMPD4 Protein (NBP2-33567PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMPD4 Antibody

  • KIAA1418
  • NET13
  • Neutral Sphingomyelinase 3
  • Neutral Sphingomyelinase III
  • NSMASE3
  • NSMASE-3
  • SKNY Protein
  • Sphingomyelin Phosphodiesterase 4
  • Sphingomyelin Phosphodiesterase 4, Neutral Membrane (Neutral Sphingomyelinase-3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7184
Species: Hu
Applications: WB
NBP1-87810
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45889
Species: Hu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-84735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4256
Species: Hu
Applications: WB
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-48546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33567
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SMPD4 Antibody (NBP2-33567) (0)

There are no publications for SMPD4 Antibody (NBP2-33567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMPD4 Antibody (NBP2-33567) (0)

There are no reviews for SMPD4 Antibody (NBP2-33567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMPD4 Antibody (NBP2-33567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-33567

Bioinformatics Tool for SMPD4 Antibody (NBP2-33567)

Discover related pathways, diseases and genes to SMPD4 Antibody (NBP2-33567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SMPD4

There are no specific blogs for SMPD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMPD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMPD4
Uniprot