SMG1 Antibody (5N10C7)

Western Blot: SMG1 Antibody (5N10C7) [NBP3-15716] - Western blot analysis of extracts of various cell lines, using SMG1 antibody (NBP3-15716) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 5N10C7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SMG1 Antibody (5N10C7) Summary

• Description: Novus Biologicals Rabbit SMG1 Antibody (5N10C7) (NBP3-15716) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 3562-3661 of human SMG1 (Q96Q15). LIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SMG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SMG1 Antibody (5N10C7)

• ATXserine/threonine-protein kinase SMG1
• EC 2.7.11
• EC 2.7.11.1
• hSMG-1,61E3.4
• KIAA0421phosphatidylinositol 3-kinase-related protein kinase
• Lambda/iota protein kinase C-interacting protein
• Lambda-interacting protein
• LIPPI-3-kinase-related kinase SMG-1
• phosphatidylinositol 3-kinase-related kinase
• SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans)
• SMG-1

Background

SMG1 encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMG1