SMARCA5/SNF2H Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCA5/SNF2H (NP_003592). Peptide sequence AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SMARCA5 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Chromatin Immunoprecipitation (ChIP)
- Western Blot 1.0 ug/ml
|
Theoretical MW |
122 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for SMARCA5/SNF2H Antibody - BSA Free
Background
The SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin (SMARC), also called BRG1-associated factors (BAFs), have been identified as components of the human SWI/SNF-like chromatin-remodeling protein complexes. SNF2h/ISWI, also known as WCRF135, is the gene product of SMARCA5 that associates with WSTF (Williams Syndrome transcription factor) and several other nuclear proteins to mediate chromatin remodeling. SNF2h is also part of the NoRC (nucleolar remodeling complex).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
Publications for SMARCA5/SNF2H Antibody (NBP3-10883) (0)
There are no publications for SMARCA5/SNF2H Antibody (NBP3-10883).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SMARCA5/SNF2H Antibody (NBP3-10883) (0)
There are no reviews for SMARCA5/SNF2H Antibody (NBP3-10883).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SMARCA5/SNF2H Antibody (NBP3-10883) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SMARCA5/SNF2H Products
Research Areas for SMARCA5/SNF2H Antibody (NBP3-10883)
Find related products by research area.
|
Blogs on SMARCA5/SNF2H