![Western Blot: SMA4 Antibody [H00011039-B01P] - Analysis of SMA4 expression in transfected 293T cell line by SMA4 polyclonal antibody. Lane 1: SMA4 transfected lysate(15.4 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SMA4-Antibody-Western-Blot-H00011039-B01P-img0004.jpg "Western Blot: SMA4 Antibody [H00011039-B01P] - Analysis of SMA4 expression in transfected 293T cell line by SMA4 polyclonal antibody. Lane 1: SMA4 transfected lysate(15.4 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse SMA4 Antibody - Azide and BSA Free (H00011039-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | SMA4 (NP_067684.2, 1 a.a. - 140 a.a.) full-length human protein. MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV |
| Specificity | SMA4 - glucuronidase, beta pseudogene, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | SMA4 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SMA4 Antibody (H00011039-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: SMA4 Antibody [H00011039-B01P] - Analysis of purified antibody to SMA4 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/SMA4-Antibody-Immunocytochemistry-Immunofluorescence-H00011039-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: SMA4 Antibody [H00011039-B01P] - Analysis of purified antibody to SMA4 on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot STAT2 Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT2_PAFST2_Western_Blot_21973.jpg)
![Knockout Validated STAT2 Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT2_PAFST2_Knockout_Validated_21974.jpg)
![Western Blot STAT2 Antibody [Unconjugated]](https://images.novusbio.com/images/paf-st2_human-stat2-affinity-purified-polyclonal-ab-western-blot-12122025854110.jpg)
![Western Blot NAIP Antibody [Unconjugated]](https://images.novusbio.com/images2/NAIP_AF829_Western_Blot_5918.jpg)
![Simple Western Thrombospondin-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombospondin4_AF2390_Simple_Western_16991.jpg)
![Western Blot Thrombospondin-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombospondin-4_AF2390_Western_Blot_11766.jpg)
![Immunocytochemistry/ Immunofluorescence Thrombospondin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/af2390_human-thrombospondin-4-affinity-purified-polyclonal-ab-41202412403583.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")