SLMAP Antibody (2A7)

Images

 
Western Blot: SLMAP Antibody (2A7) [H00007871-M08] - Analysis of SLMAP expression in A-431 (Cat # L015V1).
Immunohistochemistry-Paraffin: SLMAP Antibody (2A7) [H00007871-M08] - Analysis of monoclonal antibody to SLMAP on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml
ELISA: SLMAP Antibody (2A7) [H00007871-M08] - Detection limit for recombinant GST tagged SLMAP is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLMAP Antibody (2A7) Summary

Immunogen
SLMAP (NP_009090 677 a.a. - 784 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPW
Specificity
SLMAP - sarcolemma associated protein
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLMAP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using
H00007871-M08 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLMAP Antibody (2A7)

  • FLJ42206
  • KIAA1601Sarcolemmal-associated protein
  • MGC138760
  • sarcolemma associated protein
  • sarcolemmal membrane-associated protein
  • SLAPMGC138761

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24696
Species: Hu
Applications: IHC-P
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
MAB3857
Species: Hu
Applications: WB
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NB100-2307
Species: Hu
Applications: WB
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00007871-M08
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for SLMAP Antibody (H00007871-M08)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SLMAP Antibody (H00007871-M08) (0)

There are no reviews for SLMAP Antibody (H00007871-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLMAP Antibody (H00007871-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLMAP Products

Bioinformatics Tool for SLMAP Antibody (H00007871-M08)

Discover related pathways, diseases and genes to SLMAP Antibody (H00007871-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLMAP Antibody (H00007871-M08)

Discover more about diseases related to SLMAP Antibody (H00007871-M08).
 

Pathways for SLMAP Antibody (H00007871-M08)

View related products by pathway.

PTMs for SLMAP Antibody (H00007871-M08)

Learn more about PTMs related to SLMAP Antibody (H00007871-M08).

Blogs on SLMAP

There are no specific blogs for SLMAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLMAP Antibody (2A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLMAP
Entrez
OMIM
Uniprot