SLC9A9 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC9A9 Antibody [NBP2-34102] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells and non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC9A9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAIL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC9A9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC9A9 Protein (NBP2-34102PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC9A9 Antibody - BSA Free

• AUTS16
• FLJ35613
• Na(+)/H(+) exchanger 9
• Nbla00118
• NHE9
• NHE-9
• putative protein product of Nbla00118
• SLC9A9
• sodium/hydrogen exchanger 9
• sodium/proton exchanger NHE9
• solute carrier family 9 (sodium/hydrogen exchanger)
• solute carrier family 9 (sodium/hydrogen exchanger), isoform 9
• solute carrier family 9 (sodium/hydrogen exchanger), member 9
• Solute carrier family 9 member 9

Background

SLC9A9 may act in electroneutral exchange of protons for Na(+) across membranes. Involved in the effusion of Golgiluminal H(+) in exchange for cytosolic cations. Involved in organelleion homeostasis by contributing to themaintainance of the unique acidic pH val

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC9A9
• Uniprot:
  • Q8IVB4(Mouse)