SLC7A7 Antibody (3B10) - Azide and BSA Free

Sandwich ELISA: SLC7A7 Antibody (3B10) [H00009056-M04] - Detection limit for recombinant GST tagged SLC7A7 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 3B10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC7A7 Antibody (3B10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SLC7A7 (NP_003973.2, 462 a.a. ~ 511 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
• Specificity: SLC7A7 - solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 (3B10)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC7A7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC7A7 Antibody (3B10) - Azide and BSA Free

• LAT3
• LPI
• Monocyte amino acid permease 2
• MOP-2
• SLC7A7
• solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
• Solute carrier family 7 member 7
• Y+L amino acid transporter 1
• Y+LAT1
• y+LAT-1y(+)L-type amino acid transporter 1

Background

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC7A7
• Entrez:
  • 9056(Human)