SLC7A7 Antibody (3B10)

Images

 
Sandwich ELISA: SLC7A7 Antibody (3B10) [H00009056-M04] - Detection limit for recombinant GST tagged SLC7A7 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC7A7 Antibody (3B10) Summary

Immunogen
SLC7A7 (NP_003973.2 462 a.a. - 511 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
Specificity
SLC7A7 - solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 (3B10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC7A7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC7A7 Antibody (3B10)

  • LAT3
  • LPI
  • Monocyte amino acid permease 2
  • MOP-2
  • SLC7A7
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
  • Solute carrier family 7 member 7
  • Y+L amino acid transporter 1
  • Y+LAT1
  • y+LAT-1y(+)L-type amino acid transporter 1

Background

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NLS164
Species: Hu
Applications: IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
2984-SE
Species: Hu
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-58924
Species: Hu
Applications: ICC/IF
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for SLC7A7 Antibody (H00009056-M04) (0)

There are no publications for SLC7A7 Antibody (H00009056-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A7 Antibody (H00009056-M04) (0)

There are no reviews for SLC7A7 Antibody (H00009056-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC7A7 Antibody (H00009056-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC7A7 Products

Bioinformatics Tool for SLC7A7 Antibody (H00009056-M04)

Discover related pathways, diseases and genes to SLC7A7 Antibody (H00009056-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A7 Antibody (H00009056-M04)

Discover more about diseases related to SLC7A7 Antibody (H00009056-M04).
 

Pathways for SLC7A7 Antibody (H00009056-M04)

View related products by pathway.

PTMs for SLC7A7 Antibody (H00009056-M04)

Learn more about PTMs related to SLC7A7 Antibody (H00009056-M04).

Blogs on SLC7A7

There are no specific blogs for SLC7A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A7 Antibody (3B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A7
Entrez