We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SLC5A11 Recombinant Protein Antigen

Images

 
There are currently no images for SLC5A11 Protein (NBP1-82862PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC5A11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC5A11.

Source: E. coli

Amino Acid Sequence: EPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC5A11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82862.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC5A11 Recombinant Protein Antigen

  • KST1RKST1
  • Na(+)/myo-inositol cotransporter 2
  • na+/myo-inositol cotransporter 2
  • putative sodium-coupled cotransporter RKST1
  • SGLT6
  • SLGTX
  • SMIT2homolog of rabbit KST1
  • Sodium/glucose cotransporter KST1
  • sodium/myo-inositol cotransporter 2
  • Sodium-dependent glucose cotransporter
  • solute carrier family 5 (sodium/glucose cotransporter), member 11
  • Solute carrier family 5 member 11

Background

Cotransporters, such as SLC5A11, represent a major class of proteins that make use of ion gradients to drive activetransport for the cellular accumulation of nutrients, neurotransmitters, osmolytes, and ions Roll et al. (2002)(PubMed 12039040).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-02399
Species: Bt, Bv, Ca, Ha, Hu, Pm, Rb
Applications: IHC,  IHC-P
NBP1-92384
Species: Hu
Applications: IHC,  IHC-P
NBP1-87835
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-17114
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-22218
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
DRA00B
Species: Hu
Applications: ELISA
211-TBB/CF
Species: Hu
Applications: BA
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
AF5769
Species: Hu
Applications: IHC, WB
AF1936
Species: Hu
Applications: IP, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB

Publications for SLC5A11 Protein (NBP1-82862PEP) (0)

There are no publications for SLC5A11 Protein (NBP1-82862PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC5A11 Protein (NBP1-82862PEP) (0)

There are no reviews for SLC5A11 Protein (NBP1-82862PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC5A11 Protein (NBP1-82862PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC5A11 Products

Research Areas for SLC5A11 Protein (NBP1-82862PEP)

Find related products by research area.

Blogs on SLC5A11

There are no specific blogs for SLC5A11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC5A11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC5A11