We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SLC4A9 Recombinant Protein Antigen

Images

 
There are currently no images for SLC4A9 Protein (NBP2-13340PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC4A9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC4A9.

Source: E. coli

Amino Acid Sequence: LVLLDCPAQSLLELVEQVTRVESLSPELRGQLQALLLQRPQHYNQTTGTRPCWGSTHPRKASDNEEAPLREQCQNP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC4A9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13340.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC4A9 Recombinant Protein Antigen

  • anion exchange protein 4
  • AE4
  • solute carrier family 4, sodium bicarbonate cotransporter, member 9

Background

SLC4A9, also referred to as Solute Carrier Family 4, Sodium Bicarbonate Cotransporter, Member 9, has a 983 amino acid long isoform that is approximately 108kDa (the canonical sequence) and three other isoforms produced by alternative splicing. SLC4A9 is a transmembrane protein that is predominately expressed in the kidney where it functions in anion exchange. Current research on SLC4A9 is being performed in relation to several diseases and disorders including neuronitis and hidradenoma. SLC4A9 is involved in several pathways such as the SLC-mediated transmembrane transport pathway and the Bicarbonate transporters pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87850
Species: Hu
Applications:  IHC-P
NBP2-32020
Species: Hu
Applications: IHC,  IHC-P
H00009498-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-82594
Species: Hu
Applications: IHC,  IHC-P
NBP1-46156
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-93493
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-47273
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-76847
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85237
Species: Hu
Applications: IHC,  IHC-P
NBP1-84450
Species: Hu
Applications: IHC-WhMt, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP1-90225
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-16518
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03107
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB

Publications for SLC4A9 Protein (NBP2-13340PEP) (0)

There are no publications for SLC4A9 Protein (NBP2-13340PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC4A9 Protein (NBP2-13340PEP) (0)

There are no reviews for SLC4A9 Protein (NBP2-13340PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC4A9 Protein (NBP2-13340PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC4A9 Products

Array NBP2-13340PEP

Blogs on SLC4A9

There are no specific blogs for SLC4A9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC4A9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC4A9