SLC4A11 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC4A11 Antibody [NBP1-88514] - Staining of human testis shows strong positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC4A11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TNTENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC4A11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC4A11 Protein (NBP1-88514PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC4A11 Antibody

  • Bicarbonate transporter-related protein 1
  • BTR1bicarbonate transporter related protein 1
  • CDPD
  • CHED2
  • corneal endothelial dystrophy 2 (autosomal recessive)
  • dJ794I6.2
  • FECD4
  • MGC126418
  • MGC126419
  • NaBC1
  • sodium bicarbonate transporter-like protein 11
  • Sodium borate cotransporter 1
  • sodium-coupled borate cotransporter 1
  • Solute carrier family 4 member 11
  • solute carrier family 4, sodium bicarbonate transporter-like, member 11
  • solute carrier family 4, sodium borate transporter, member 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008621-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-30020
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP2-13340
Species: Hu
Applications: IHC, IHC-P
NBP1-82594
Species: Hu
Applications: IHC, IHC-P
NBP2-38736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
H00009498-M04
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
640-A3
Species: Mu
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-59528
Species: Hu
Applications: WB
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P

Publications for SLC4A11 Antibody (NBP1-88514) (0)

There are no publications for SLC4A11 Antibody (NBP1-88514).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC4A11 Antibody (NBP1-88514) (0)

There are no reviews for SLC4A11 Antibody (NBP1-88514). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC4A11 Antibody (NBP1-88514) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC4A11 Products

Bioinformatics Tool for SLC4A11 Antibody (NBP1-88514)

Discover related pathways, diseases and genes to SLC4A11 Antibody (NBP1-88514). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC4A11 Antibody (NBP1-88514)

Discover more about diseases related to SLC4A11 Antibody (NBP1-88514).
 

Pathways for SLC4A11 Antibody (NBP1-88514)

View related products by pathway.

Research Areas for SLC4A11 Antibody (NBP1-88514)

Find related products by research area.

Blogs on SLC4A11

There are no specific blogs for SLC4A11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC4A11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC4A11