SLC38A10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC38A10 Antibody [NBP1-81195] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81195] - Staining in human gallbladder and skeletal muscle tissues using anti-SLC38A10 antibody. Corresponding SLC38A10 RNA-seq data ...read more
Immunohistochemistry: SLC38A10 Antibody [NBP1-81195] - Staining of human stomach shows strong cytoplasmic positivity with granular pattern.
Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81195] - Staining of human gallbladder shows high expression.
Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81195] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLC38A10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVPHDKVVVDEGQDREVPEENKPPSRHAGGKAPGVQGQMAPPLPDSEREKQEPEQGEVGKRPGQAQALEEAGDLPEDPQKVPEADGQPA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC38A10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC38A10 Protein (NBP1-81195PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC38A10 Antibody

  • FLJ35718
  • FLJ46399
  • MGC15523
  • PP1744
  • putative sodium-coupled neutral amino acid transporter 10
  • solute carrier family 38, member 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55228
Species: Hu
Applications: IHC, IHC-P, WB
366-6C/CF
Species: Hu
Applications: BA
NBP2-59311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-06385
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87910
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
NBP1-81010
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-92402
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC38A10 Antibody (NBP1-81195) (0)

There are no publications for SLC38A10 Antibody (NBP1-81195).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC38A10 Antibody (NBP1-81195) (0)

There are no reviews for SLC38A10 Antibody (NBP1-81195). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC38A10 Antibody (NBP1-81195) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC38A10 Products

Bioinformatics Tool for SLC38A10 Antibody (NBP1-81195)

Discover related pathways, diseases and genes to SLC38A10 Antibody (NBP1-81195). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC38A10 Antibody (NBP1-81195)

Discover more about diseases related to SLC38A10 Antibody (NBP1-81195).
 

Pathways for SLC38A10 Antibody (NBP1-81195)

View related products by pathway.

Blogs on SLC38A10

There are no specific blogs for SLC38A10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC38A10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC38A10
Entrez