Recombinant Human SLC35B2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SLC35B2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 432 of Human SLC35B2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFMVPGYLLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCATGLQVSYLTWGVLQERVMTRSYGATATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIGVSMFLLSSGPEPRSSPATTLSGLILLAGYIAFDSFTSNWQDALFAYKMSSVQMMFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSACGQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGKKAVPVESPVQKV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SLC35B2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
73.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC35B2 GST (N-Term) Protein

  • adenosine 3'-phospho 5'-phosphosulfate transporter 1
  • PAPS transporter 1
  • PAPST13'-phosphoadenosine 5'-phosphosulfate transporter
  • Putative MAPK-activating protein PM15
  • Putative NF-kappa-B-activating protein 48
  • SLL
  • solute carrier family 35 member B2 variant 2
  • Solute carrier family 35 member B2
  • solute carrier family 35, member B2
  • UGTrel4

Background

Sulfotransferases (e.g., SULT4A1; MIM 608359) use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen (Kamiyama et al., 2003 [PubMed 12716889]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60490
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-37943
Species: Hu
Applications: IHC, IHC-P
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NBP2-70360
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF123
Species: Hu
Applications: Block, ICC, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB2806
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-58297
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-46125
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP1-87697
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for SLC35B2 Recombinant Protein (H00347734-P01) (0)

There are no publications for SLC35B2 Recombinant Protein (H00347734-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35B2 Recombinant Protein (H00347734-P01) (0)

There are no reviews for SLC35B2 Recombinant Protein (H00347734-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC35B2 Recombinant Protein (H00347734-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC35B2 Products

Bioinformatics Tool for SLC35B2 Recombinant Protein (H00347734-P01)

Discover related pathways, diseases and genes to SLC35B2 Recombinant Protein (H00347734-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35B2 Recombinant Protein (H00347734-P01)

Discover more about diseases related to SLC35B2 Recombinant Protein (H00347734-P01).
 

Pathways for SLC35B2 Recombinant Protein (H00347734-P01)

View related products by pathway.

PTMs for SLC35B2 Recombinant Protein (H00347734-P01)

Learn more about PTMs related to SLC35B2 Recombinant Protein (H00347734-P01).

Blogs on SLC35B2

There are no specific blogs for SLC35B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC35B2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC35B2