SLC2A13 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC2A13 Antibody [NBP1-83245] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear membrane.
Immunohistochemistry-Paraffin: SLC2A13 Antibody [NBP1-83245] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC2A13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC2A13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC2A13 Protein (NBP1-83245PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC2A13 Antibody

  • H(+)-myo-inositol cotransporter
  • H(+)-myo-inositol symporter
  • Hmit
  • HMITproton (H+) myo-inositol symporter
  • MGC48624
  • proton myo-inositol cotransporter
  • solute carrier family 2 (facilitated glucose transporter), member 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-02399
Species: Hu, Bt, Bv, Ca, Ha, Mk, Rb
Applications: IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82862
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47980
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-81821
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-59812
Species: Hu
Applications: WB
NBP2-20338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NB100-490
Species: Hu, Mu
Applications: WB, ICC/IF
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00144195-R01
Species: Hu
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83245
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC2A13 Antibody (NBP1-83245) (0)

There are no publications for SLC2A13 Antibody (NBP1-83245).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC2A13 Antibody (NBP1-83245) (0)

There are no reviews for SLC2A13 Antibody (NBP1-83245). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC2A13 Antibody (NBP1-83245) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC2A13 Products

Bioinformatics Tool for SLC2A13 Antibody (NBP1-83245)

Discover related pathways, diseases and genes to SLC2A13 Antibody (NBP1-83245). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC2A13 Antibody (NBP1-83245)

Discover more about diseases related to SLC2A13 Antibody (NBP1-83245).
 

Pathways for SLC2A13 Antibody (NBP1-83245)

View related products by pathway.

PTMs for SLC2A13 Antibody (NBP1-83245)

Learn more about PTMs related to SLC2A13 Antibody (NBP1-83245).

Blogs on SLC2A13

There are no specific blogs for SLC2A13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC2A13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A13
Entrez
Uniprot