SLC26A4 Antibody (3D2) - Azide and BSA Free

ELISA: SLC26A4 Antibody (3D2) [H00005172-M03] - Detection limit for recombinant GST tagged SLC26A4 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 3D2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC26A4 Antibody (3D2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SLC26A4 (NP_000432, 674 a.a. ~ 754 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKD
• Specificity: SLC26A4 (3D2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC26A4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC26A4 Antibody (3D2) - Azide and BSA Free

• DFNB4
• EVA
• PDSTDH2B
• pendrin
• Sodium-independent chloride/iodide transporter
• Solute carrier family 26 member 4
• solute carrier family 26, member 4

Background

Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC26A4
• Entrez:
  • 5172(Human)
• OMIM:
  • 274600(Human)
• Uniprot:
  • NP_000432(Human)