Recombinant Human SLC25A28 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SLC25A28 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-177 of Human SLC25A28 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEWRAGK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SLC25A28
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
46.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC25A28 Protein

  • DKFZp547C109
  • hMRS3/4
  • MFRN2
  • Mitochondrial iron transporter 2
  • Mitochondrial RNA-splicing protein 3/4 homolog
  • mitoferrin-2
  • MRS3/4MRS4Lmitochondrial RNA splicing protein 3/4
  • NPD016
  • putative mitochondrial solute carrier
  • Solute carrier family 25 member 28
  • solute carrier family 25, member 28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-1798
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP2-47572
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-93525
Species: Hu
Applications: IHC, IHC-P
NBP2-14961
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00081894-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SLC25A28 Recombinant Protein (H00081894-P01) (0)

There are no publications for SLC25A28 Recombinant Protein (H00081894-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A28 Recombinant Protein (H00081894-P01) (0)

There are no reviews for SLC25A28 Recombinant Protein (H00081894-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A28 Recombinant Protein (H00081894-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SLC25A28 Recombinant Protein (H00081894-P01)

Discover related pathways, diseases and genes to SLC25A28 Recombinant Protein (H00081894-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A28 Recombinant Protein (H00081894-P01)

Discover more about diseases related to SLC25A28 Recombinant Protein (H00081894-P01).
 

Pathways for SLC25A28 Recombinant Protein (H00081894-P01)

View related products by pathway.

Blogs on SLC25A28

There are no specific blogs for SLC25A28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IRP2 Antibody
NB100-1798

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC25A28 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A28