Recombinant Human SLC25A25 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC25A25 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 110 of Human SLC25A25 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC25A25
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC25A25 Protein

  • APC3
  • calcium-binding mitochondrial carrier protein SCaMC-2
  • KIAA1896RP11-395P17.4
  • MCSC
  • MCSC3
  • MGC105138
  • MGC119514
  • MGC119515
  • MGC119516
  • MGC119517
  • Mitochondrial ATP-Mg/Pi carrier protein 3
  • Mitochondrial Ca(2+)-dependent solute carrier protein 3
  • mitochondrial Ca2+-dependent solute carrier
  • PCSCL
  • SCAMC2
  • SCAMC-2
  • short calcium-binding mitochondrial carrier 2
  • small calcium-binding mitochondrial carrier 2
  • Small calcium-binding mitochondrial carrier protein 2
  • solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
  • Solute carrier family 25 member 25
  • solute carrier family 25, member 25

Background

SLC25A25 - solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-57669
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-40367
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00114789-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SLC25A25 Partial Recombinant Protein (H00114789-Q01) (0)

There are no publications for SLC25A25 Partial Recombinant Protein (H00114789-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A25 Partial Recombinant Protein (H00114789-Q01) (0)

There are no reviews for SLC25A25 Partial Recombinant Protein (H00114789-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A25 Partial Recombinant Protein (H00114789-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC25A25 Products

Bioinformatics Tool for SLC25A25 Partial Recombinant Protein (H00114789-Q01)

Discover related pathways, diseases and genes to SLC25A25 Partial Recombinant Protein (H00114789-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A25 Partial Recombinant Protein (H00114789-Q01)

Discover more about diseases related to SLC25A25 Partial Recombinant Protein (H00114789-Q01).
 

Pathways for SLC25A25 Partial Recombinant Protein (H00114789-Q01)

View related products by pathway.

Blogs on SLC25A25

There are no specific blogs for SLC25A25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

APC Antibody
NB100-91662

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC25A25 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A25