SLC25A24 Antibody - BSA Free

Western Blot: SLC25A24 Antibody [NBP1-60063] - Human Thymus lysate, concentration 2.5 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

SLC25A24 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC25A24(solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24) The peptide sequence was selected from the middle region of SLC25A24. Peptide sequence FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A24
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for SLC25A24 Antibody - BSA Free

• APC1calcium-binding mitochondrial carrier protein SCaMC-1
• calcium-binding transporter
• DKFZp586G0123
• MCSC1
• Mitochondrial ATP-Mg/Pi carrier protein 1
• mitochondrial ATP-Mg/Pi transporter
• Mitochondrial Ca(2+)-dependent solute carrier protein 1
• SCAMC1
• SCAMC-1
• short calcium-binding mitochondrial carrier 1
• Small calcium-binding mitochondrial carrier protein 1
• solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
• Solute carrier family 25 member 24

Background

SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A24