SLC25A23 Antibody (3E1)

Images

 
Sandwich ELISA: SLC25A23 Antibody (3E1) [H00079085-M04] - Detection limit for recombinant GST tagged SLC25A23 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3E1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC25A23 Antibody (3E1) Summary

Immunogen
SLC25A23 (NP_077008.2, 2 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRY
Specificity
SLC25A23 - solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 (3E1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC25A23
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC25A23 Antibody (3E1)

  • APC2FLJ30339
  • calcium-binding mitochondrial carrier protein SCaMC-3
  • MCSC2
  • MGC2615
  • Mitochondrial ATP-Mg/Pi carrier protein 2
  • Mitochondrial Ca(2+)-dependent solute carrier protein 2
  • mitochondrial Ca2+-dependent solute carrier protein 2
  • SCAMC3
  • SCaMC-3
  • short calcium-binding mitochondrial carrier 3
  • Small calcium-binding mitochondrial carrier protein 3
  • solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23
  • Solute carrier family 25 member 23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-57669
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77375
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP2-45493
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-89095
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-82886
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-61889
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-67818
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67820
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-75659
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-59828
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB

Publications for SLC25A23 Antibody (H00079085-M04) (0)

There are no publications for SLC25A23 Antibody (H00079085-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A23 Antibody (H00079085-M04) (0)

There are no reviews for SLC25A23 Antibody (H00079085-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A23 Antibody (H00079085-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A23 Products

Bioinformatics Tool for SLC25A23 Antibody (H00079085-M04)

Discover related pathways, diseases and genes to SLC25A23 Antibody (H00079085-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A23 Antibody (H00079085-M04)

Discover more about diseases related to SLC25A23 Antibody (H00079085-M04).
 

Pathways for SLC25A23 Antibody (H00079085-M04)

View related products by pathway.

Blogs on SLC25A23

There are no specific blogs for SLC25A23, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A23 Antibody (3E1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A23
Entrez
Uniprot