SLC24A6 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC24A6 Antibody [NBP1-83607] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: SLC24A6 Antibody [NBP1-83607] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: SLC24A6 Antibody [NBP1-83607] - Staining of small intestine shows strong granular cytoplasmic positivity in glandular cells.

Staining of human pancreas shows strong positivity in mitochondria in exocrine glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC24A6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC24A6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC24A6 Protein (NBP1-83607PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC24A6 Antibody - BSA Free

• FLJ22233
• NCKX6Na(+)/K(+)/Ca(2+)-exchange protein 6
• NCLX
• sodium/potassium/calcium exchanger 6
• solute carrier family 24 (sodium/potassium/calcium exchanger), member 6
• Solute carrier family 24 member 6

Background

SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion (Cai and Lytton, 2004 [PubMed 14625281]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC24A6