SLC24A3 Antibody

Images

 
Western Blot: SLC24A3 Antibody [NBP2-31010] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: SLC24A3 Antibody [NBP2-31010] - Staining of human cerebellum shows cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC24A3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KELDLMDLVGEDRKWMMARKLMQVNDTLTSEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC24A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC24A3 Protein (NBP2-31010PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC24A3 Antibody

  • sodium/potassium/calcium exchanger 3
  • NCKX3
  • solute carrier family 24 (sodium/potassium/calcium exchanger), member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56483
Species: Hu
Applications: ICC/IF
NBP1-92397
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59897
Species: Hu
Applications: WB
NBP1-83973
Species: Hu
Applications: IHC, IHC-P
NB300-600
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-2869
Species: Hu, Mu, Rt, Po, Bv, Ca, GP, I, Kg, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-48980
Species: Hu
Applications: IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
MAB3650
Species: Hu
Applications: Flow, CyTOF-ready
AF5745
Species: Hu
Applications: WB, IHC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-31010
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC24A3 Antibody (NBP2-31010) (0)

There are no publications for SLC24A3 Antibody (NBP2-31010).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC24A3 Antibody (NBP2-31010) (0)

There are no reviews for SLC24A3 Antibody (NBP2-31010). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC24A3 Antibody (NBP2-31010) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC24A3 Products

Bioinformatics Tool for SLC24A3 Antibody (NBP2-31010)

Discover related pathways, diseases and genes to SLC24A3 Antibody (NBP2-31010). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC24A3 Antibody (NBP2-31010)

Discover more about diseases related to SLC24A3 Antibody (NBP2-31010).
 

Pathways for SLC24A3 Antibody (NBP2-31010)

View related products by pathway.

PTMs for SLC24A3 Antibody (NBP2-31010)

Learn more about PTMs related to SLC24A3 Antibody (NBP2-31010).

Blogs on SLC24A3

There are no specific blogs for SLC24A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC24A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC24A3
Uniprot