SLC24A3 Antibody

Western Blot: SLC24A3 Antibody [NBP2-31010] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: SLC24A3 Antibody [NBP2-31010] - Staining of human cerebellum shows cytoplasmic positivity in Purkinje cells.

Product Discontinued

SLC24A3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KELDLMDLVGEDRKWMMARKLMQVNDTLTSEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC24A3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC24A3 Antibody

• sodium/potassium/calcium exchanger 3
• NCKX3
• solute carrier family 24 (sodium/potassium/calcium exchanger), member 3

Background

Plasma membrane sodium/calcium exchangers are an important component of intracellular calcium homeostasis andelectrical conduction. Potassium-dependent sodium/calcium exchangers such as SLC24A3 are believed to transport 1intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions (Kraev et al., 2001 (PubMed11294880)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC24A3
• Uniprot:
  • Q9HC58(Human)