SLC23A2 Antibody

Images

 
Western Blot: SLC23A2 Antibody [NBP2-13319] - Analysis in human cell line SK-MEL-30.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC23A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKWKCNTTDVSVANGTAELLHTEHIWYPRI
Specificity
Specificity of human SLC23A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC23A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
IHC-P reactivity reported in scientific literature (Ni K, Gill A, Cao D et al.)
Control Peptide
SLC23A2 Protein (NBP2-13319PEP)
Publications
Read Publications using
NBP2-13319 in the following applications:

  • 1 publication
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:31901552). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC23A2 Antibody

  • KIAA0238SLC23A1
  • Na(+)/L-ascorbic acid transporter 2
  • Nucleobase transporter-like 1 protein
  • Sodium-dependent vitamin C transporter 2
  • sodium-dependent vitamin C transporter-2
  • solute carrier family 23 (nucleobase transporters), member 1
  • solute carrier family 23 (nucleobase transporters), member 2
  • solute carrier family 23 member 2
  • SVCT2NBTL1
  • Yolk sac permease-like molecule 2
  • YSPL2hSVCT2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NBP2-66872
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP1-59896
Species: Hu
Applications: WB
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-66969
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IM, IP
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
DPSG10
Species: Hu
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-13319
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for SLC23A2 Antibody (NBP2-13319)(4)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(2)
All Applications
Filter By Species
Human
(2)
Mouse
(1)
All Species
Showing Publications 1 - 4 of 4.
Publications using NBP2-13319 Applications Species
Ni K, Gill A, Cao D et al. Expression and Clinicopathological Implications of the Vitamin C Transporters SVCT-1 and SVCT-2 in Colon Cancer Thesis (IHC-P, Human) IHC-P Human
Ferrada L, Vandenabeele P, Salazar K, Nualart F Vitamin C Controls Neuronal Necroptosis Under Oxidative Stress SSRN Journal Jun 10 2019
Cho S, Chae J, Shin H, et al. Enhanced Anticancer Effect of Adding Magnesium to Vitamin C Therapy: Inhibition of Hormetic Response by SVCT-2 Activation Translational Oncology Dec 31 2019 [PMID: 31901552] (WB, Mouse) WB Mouse
Cho S, Chae JS, Shin H et al. Hormetic dose response to L-ascorbic acid as an anti-cancer drug in colorectal cancer cell lines according to SVCT-2 expression. Sci Rep. Jul 27 2018 [PMID: 30054560] (WB, Human) WB Human

Reviews for SLC23A2 Antibody (NBP2-13319) (0)

There are no reviews for SLC23A2 Antibody (NBP2-13319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC23A2 Antibody (NBP2-13319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC23A2 Products

Bioinformatics Tool for SLC23A2 Antibody (NBP2-13319)

Discover related pathways, diseases and genes to SLC23A2 Antibody (NBP2-13319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC23A2 Antibody (NBP2-13319)

Discover more about diseases related to SLC23A2 Antibody (NBP2-13319).
 

Pathways for SLC23A2 Antibody (NBP2-13319)

View related products by pathway.

PTMs for SLC23A2 Antibody (NBP2-13319)

Learn more about PTMs related to SLC23A2 Antibody (NBP2-13319).

Blogs on SLC23A2

There are no specific blogs for SLC23A2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC23A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC23A2