SLC23A2 Antibody

Images

 
Western Blot: SLC23A2 Antibody [NBP2-13319] - Analysis in human adrenal gland tissue.
Immunohistochemistry-Paraffin: SLC23A2 Antibody [NBP2-13319] - Staining of human rectum shows distinct cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC23A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKWKCNTTDVSVANGTAELLHTEHIWYPRI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC23A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC23A2 Protein (NBP2-13319PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC23A2 Antibody

  • KIAA0238SLC23A1
  • Na(+)/L-ascorbic acid transporter 2
  • Nucleobase transporter-like 1 protein
  • Sodium-dependent vitamin C transporter 2
  • sodium-dependent vitamin C transporter-2
  • solute carrier family 23 (nucleobase transporters), member 1
  • solute carrier family 23 (nucleobase transporters), member 2
  • solute carrier family 23 member 2
  • SVCT2NBTL1
  • Yolk sac permease-like molecule 2
  • YSPL2hSVCT2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1415
Species: Hu
Applications: Flow, CyTOF-ready, ICC
H00144195-R01
Species: Hu
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-59896
Species: Hu
Applications: WB
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA

Publications for SLC23A2 Antibody (NBP2-13319) (0)

There are no publications for SLC23A2 Antibody (NBP2-13319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC23A2 Antibody (NBP2-13319) (0)

There are no reviews for SLC23A2 Antibody (NBP2-13319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC23A2 Antibody (NBP2-13319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC23A2 Products

Bioinformatics Tool for SLC23A2 Antibody (NBP2-13319)

Discover related pathways, diseases and genes to SLC23A2 Antibody (NBP2-13319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC23A2 Antibody (NBP2-13319)

Discover more about diseases related to SLC23A2 Antibody (NBP2-13319).
 

Pathways for SLC23A2 Antibody (NBP2-13319)

View related products by pathway.

PTMs for SLC23A2 Antibody (NBP2-13319)

Learn more about PTMs related to SLC23A2 Antibody (NBP2-13319).

Blogs on SLC23A2

There are no specific blogs for SLC23A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC23A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC23A2