SLC23A2 Antibody

Western Blot: SLC23A2 Antibody [NBP2-13319] - Analysis in human cell line SK-MEL-30.

Product Discontinued

SLC23A2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DKWKCNTTDVSVANGTAELLHTEHIWYPRI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC23A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Use in ICC/IF reported in scientific literature (PMID:33327638).

Reactivity Notes

Use in Rat reported in scientific literature (PMID:33327638). Mouse reactivity reported in scientific literature (PMID:31901552).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC23A2 Antibody

• KIAA0238SLC23A1
• Na(+)/L-ascorbic acid transporter 2
• Nucleobase transporter-like 1 protein
• Sodium-dependent vitamin C transporter 2
• sodium-dependent vitamin C transporter-2
• solute carrier family 23 (nucleobase transporters), member 1
• solute carrier family 23 (nucleobase transporters), member 2
• solute carrier family 23 member 2
• SVCT2NBTL1
• Yolk sac permease-like molecule 2
• YSPL2hSVCT2

Background

The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC23A2 Antibody (NBP2-13319)(6)

Publications using NBP2-13319

• Qin S, Wang G, Chen L et al. Pharmacological vitamin C inhibits mTOR signaling and tumor growth by degrading Rictor and inducing HMOX1 expression PLoS genetics 2023-02-01 [PMID: 36787291] (WB, Human)
• Cho S, Chae JS, Shin H et al. Hormetic dose response to L-ascorbic acid as an anti-cancer drug in colorectal cancer cell lines according to SVCT-2 expression. Sci Rep. 2018-07-27 [PMID: 30054560] (WB, Human)
• Ni K, Gill A, Cao D et al. Expression and Clinicopathological Implications of the Vitamin C Transporters SVCT-1 and SVCT-2 in Colon Cancer Thesis (IHC-P, Human)
• Espinoza F, Magdalena R, Saldivia N et al. Vitamin C Recycling Regulates Neurite Growth in Neurospheres Differentiated In Vitro Antioxidants (Basel, Switzerland) 2020-12-14 [PMID: 33327638] (ICC/IF, Rat)
• Ferrada L, Vandenabeele P, Salazar K, Nualart F Vitamin C Controls Neuronal Necroptosis Under Oxidative Stress Redox Biol 2020-01-14 [PMID: 31926631]
• Cho S, Chae J, Shin H, et al. Enhanced Anticancer Effect of Adding Magnesium to Vitamin C Therapy: Inhibition of Hormetic Response by SVCT-2 Activation Translational Oncology 2019-12-31 [PMID: 31901552] (WB, Mouse)

Bioinformatics

• Gene Symbol: SLC23A2