SLC23A1 Antibody - BSA Free

Western Blot: SLC23A1 Antibody [NBP2-93412] - Analysis of extracts of various cell lines, using SLC23A1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.

Product Discontinued

SLC23A1 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 512-598 of human SLC23A1 (NP_005838.3). DNTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKYIPICPVFKGFSSSSKDQIAIPEDTPENTETASVCTKV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC23A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC23A1 Antibody - BSA Free

• hSVCT1
• SLC23A2
• Sodium-dependent vitamin C transporter 1
• sodium-dependent vitamin C transporter-1
• solute carrier family 23 (nucleobase transporters), member 1
• solute carrier family 23 (nucleobase transporters), member 2
• solute carrier family 23 member 1
• SVCT1Na(+)/L-ascorbic acid transporter 1
• Yolk sac permease-like molecule 3
• YSPL3MGC22361

Background

The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two transporters. The encoded protein is active in bulk vitamin C transport involving epithelial surfaces. Previously, this gene had an official symbol of SLC23A2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC23A1