![Western Blot: SLC19A3 Antibody [NBP1-86943] - Analysis in control (vector only transfected HEK293T lysate) and SLC19A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/SLC19A3-Antibody-Western-Blot-NBP1-86943-img0007.jpg "Western Blot: SLC19A3 Antibody [NBP1-86943] - Analysis in control (vector only transfected HEK293T lysate) and SLC19A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC19A3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. SLC19A3 antibody validated for ICC/IF from a verified customer review. |
|
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
-(01-ml)_NBP1-86943_6686.jpg)
Enlarge |
reviewed by:
Verified Customer |
IF | Human | 03/28/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC19A3 |
![Immunohistochemistry-Paraffin: SLC19A3 Antibody [NBP1-86943] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/SLC19A3-Antibody-Immunohistochemistry-Paraffin-NBP1-86943-img0002.jpg "Immunohistochemistry-Paraffin: SLC19A3 Antibody [NBP1-86943] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.")
![CCL21/6Ckine [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "CCL21/6Ckine [Unconjugated]")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
-(01-ml)_NBP1-86943_6686.jpg)