SLC19A3 Antibody


Western Blot: SLC19A3 Antibody [NBP1-86943] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunocytochemistry/ Immunofluorescence: SLC19A3 Antibody [NBP1-86943] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SLC19A3 Antibody [NBP1-86943] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SLC19A3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECY
Specificity of human SLC19A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC19A3 Protein (NBP1-86943PEP)
Reviewed Applications
Read 1 Review rated 3
NBP1-86943 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC19A3 Antibody

  • Solute carrier family 19 member 3
  • solute carrier family 19, member 3
  • thiamine transporter 2
  • THTR2
  • ThTr-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC19A3 Antibody (NBP1-86943) (0)

There are no publications for SLC19A3 Antibody (NBP1-86943).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SLC19A3 Antibody (NBP1-86943) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-86943:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunofluorescence SLC19A3 NBP1-86943
reviewed by:
IF Human 03/28/2014


Sample TestedCultured Saos2 Cells
Commentsantibody works well, slightly high background


Blocking DetailsTBST for 1 hour at room temperature

Primary Anitbody

Dilution Ratio1:5000 in TBST, 1 hour at room temperature

Secondary Antibody

Secondary Descriptionanti-rabbit Alexa594
Secondary Manufacturer Cat#ab150092
Secondary Concentration1:1000 in TBST


Detection NotesOpera high-throughput confocal microscope
Fixation DetailsFixed for 20 minutes with paraformaldehyde, permeabilized with TBST
Wash DescriptionTBST, 3 washes at 5 minutes each


Commentsantibody works well, slightly high background

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC19A3 Antibody (NBP1-86943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC19A3 Products

Bioinformatics Tool for SLC19A3 Antibody (NBP1-86943)

Discover related pathways, diseases and genes to SLC19A3 Antibody (NBP1-86943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC19A3 Antibody (NBP1-86943)

Discover more about diseases related to SLC19A3 Antibody (NBP1-86943).

Pathways for SLC19A3 Antibody (NBP1-86943)

View related products by pathway.

PTMs for SLC19A3 Antibody (NBP1-86943)

Learn more about PTMs related to SLC19A3 Antibody (NBP1-86943).

Blogs on SLC19A3

There are no specific blogs for SLC19A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IF
Species: Human


Gene Symbol SLC19A3