SLC15A3 Antibody

Product Discontinued

SLC15A3 Antibody Summary

• Immunogen: Synthetic peptides corresponding to the C terminal of Slc15a3. Immunizing peptide sequence ILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFRTNPNISLLLRSDSS.
• Predicted Species: Rat (100%), Canine (93%), Equine (100%), Rabbit (100%), Bovine (93%), Guinea Pig (100%). Backed by our 100% Guarantee.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC15A3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against Slc15a3 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC15A3 Antibody

• FLJ26631
• hPTR3
• OCTP
• Osteoclast Transporter
• Peptide Transporter 3
• Peptide/Histidine Transporter 2
• PHT2
• PHT2PTR3
• PTR3
• SLC15A3
• solute carrier family 15 member 3
• solute carrier family 15, member 3

Background

Slc15a3 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC15A3
• Uniprot:
  • Q8BPX9(Mouse)