SLC13A4 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC13A4 Antibody [NBP2-13313] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC13A4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYR SHHDQMICKCLSLSI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC13A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC13A4 Protein (NBP2-13313PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC13A4 Antibody

  • Na(+)/sulfate cotransporter SUT-1
  • naS2
  • solute carrier family 13 (sodium/sulfate symporters), member 4
  • solute carrier family 13 (sodium/sulphate symporters), member 4
  • sulphate transporter 1
  • SUT-1
  • SUT1solute carrier family 13 member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30984
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-62518
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60965
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-13537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92394
Species: Hu
Applications: IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
H00001836-M04
Species: Hu
Applications: WB, ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-58924
Species: Hu
Applications: ICC/IF
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC13A4 Antibody (NBP2-13313) (0)

There are no publications for SLC13A4 Antibody (NBP2-13313).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC13A4 Antibody (NBP2-13313) (0)

There are no reviews for SLC13A4 Antibody (NBP2-13313). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC13A4 Antibody (NBP2-13313) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC13A4 Products

Bioinformatics Tool for SLC13A4 Antibody (NBP2-13313)

Discover related pathways, diseases and genes to SLC13A4 Antibody (NBP2-13313). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC13A4 Antibody (NBP2-13313)

Discover more about diseases related to SLC13A4 Antibody (NBP2-13313).
 

Pathways for SLC13A4 Antibody (NBP2-13313)

View related products by pathway.

PTMs for SLC13A4 Antibody (NBP2-13313)

Learn more about PTMs related to SLC13A4 Antibody (NBP2-13313).

Blogs on SLC13A4

There are no specific blogs for SLC13A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC13A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC13A4