ZC3H14 Antibody

Images

 
Western Blot: ZC3H14 Antibody [NBP2-13537] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: ZC3H14 Antibody [NBP2-13537] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human stomach, upper shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZC3H14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETG RLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC3H14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
ZC3H14 Protein (NBP2-13537PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZC3H14 Antibody

  • FLJ11806
  • Mammalian suppressor of tau pathology-2
  • MGC26892
  • MSUT-2
  • nuclear protein UKp68
  • NY-REN-37
  • Renal carcinoma antigen NY-REN-37
  • SUT2
  • UKp68
  • zinc finger CCCH domain-containing protein 14
  • zinc finger CCCH-type containing 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13313
Species: Hu
Applications: IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-19462
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81743
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89240
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-81745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13643
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZC3H14 Antibody (NBP2-13537) (0)

There are no publications for ZC3H14 Antibody (NBP2-13537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZC3H14 Antibody (NBP2-13537) (0)

There are no reviews for ZC3H14 Antibody (NBP2-13537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZC3H14 Antibody (NBP2-13537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZC3H14 Products

Bioinformatics Tool for ZC3H14 Antibody (NBP2-13537)

Discover related pathways, diseases and genes to ZC3H14 Antibody (NBP2-13537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZC3H14 Antibody (NBP2-13537)

Discover more about diseases related to ZC3H14 Antibody (NBP2-13537).
 

Pathways for ZC3H14 Antibody (NBP2-13537)

View related products by pathway.

PTMs for ZC3H14 Antibody (NBP2-13537)

Learn more about PTMs related to ZC3H14 Antibody (NBP2-13537).

Blogs on ZC3H14

There are no specific blogs for ZC3H14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZC3H14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3H14